KEGG   Homo sapiens (human): 3716Help
Entry
3716              CDS       T01001                                 

Gene name
JAK1, JAK1A, JAK1B, JTK3
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04621  NOD-like receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06122  IFN signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06219  JAK-STAT signaling
nt06222  IFN signaling
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00415  IL10-Jak-STAT signaling pathway
N00416  HCMV IL10 to IL10-JAK-STAT signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
Drug target
Abrocitinib: D11400
Baricitinib: D10308
Brepocitinib (DG03044): D11537 D11538
Delgocitinib: D11046
Filgotinib (DG01991): D10871 D10872 D11106
Itacitinib (DG02833): D10944 D10945
Momelotinib (DG01366): D10315 D10358
Oclacitinib (DG02005): D10141 D10142
Peficitinib (DG01853): D10653 D10721
Ruxolitinib (DG00719): D09959 D09960
Solcitinib: D10728
Tofacitinib (DG00742): D09783 D09970
Upadacitinib (DG02829): D10994 D10995 D11048
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3716 (JAK1)
   04151 PI3K-Akt signaling pathway
    3716 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3716 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3716 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    3716 (JAK1)
   04658 Th1 and Th2 cell differentiation
    3716 (JAK1)
   04659 Th17 cell differentiation
    3716 (JAK1)
  09158 Development
   04380 Osteoclast differentiation
    3716 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3716 (JAK1)
   05203 Viral carcinogenesis
    3716 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3716 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    3716 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3716 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3716 (JAK1)
   05162 Measles
    3716 (JAK1)
   05164 Influenza A
    3716 (JAK1)
   05161 Hepatitis B
    3716 (JAK1)
   05160 Hepatitis C
    3716 (JAK1)
   05168 Herpes simplex virus 1 infection
    3716 (JAK1)
   05163 Human cytomegalovirus infection
    3716 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3716 (JAK1)
   05169 Epstein-Barr virus infection
    3716 (JAK1)
   05165 Human papillomavirus infection
    3716 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3716 (JAK1)
   05140 Leishmaniasis
    3716 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3716 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3716 (JAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3716 (JAK1)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   3716 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 FERM_M
Motif
Other DBs
NCBI-GeneID: 3716
NCBI-ProteinID: NP_001307852
OMIM: 147795
HGNC: 6190
Ensembl: ENSG00000162434
Vega: OTTHUMG00000009310
Pharos: P23458(Tclin)
UniProt: P23458 Q6P669
LinkDB All DBs
Structure
PDB: 

Position
1p31.3
AA seq 1154 aa AA seqDB search
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEEL
CIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEQVQGAQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFML
KRCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSG
TLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRD
VENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNL
LLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFG
TTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRA
IMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDN
TGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLP
SGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIG
DFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDS
DSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRT
SFQNLIEGFEALLK
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgaggtgaacctggaggcccctgagccaggggtggaagtgatcttc
tatctgtcggacagggagcccctccggctgggcagtggagagtacacagcagaggaactg
tgcatcagggctgcacaggcatgccgtatctctcctctttgtcacaacctctttgccctg
tatgacgagaacaccaagctctggtatgctccaaatcgcaccatcaccgttgatgacaag
atgtccctccggctccactaccggatgaggttctatttcaccaattggcatggaaccaac
gacaatgagcagtcagtgtggcgtcattctccaaagaagcagaaaaatggctacgagaaa
aaaaagattccagatgcaacccctctccttgatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtgaaatgcctggctcctattcgagaccccaagaccgagcag
gatggacatgatattgagaacgagtgtctagggatggctgtcctggccatctcacactat
gccatgatgaagaagatgcagttgccagaactgcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacgcatgacctgaaggtgaaatacttggctaccttggaaactttgacaaaacat
tacggtgctgaaatatttgagacttccatgttactgatttcatcagaaaatgagatgaat
tggtttcattcgaatgacggtggaaacgttctctactacgaagtgatggtgactgggaat
cttggaatccagtggaggcataaaccaaatgttgtttctgttgaaaaggaaaaaaataaa
ctgaagcggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaagatccgg
gaagagtggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtct
gtggtcagcattaacaagcaggacaacaagaaaatggaactgaagctctcttcccacgag
gaggccttgtcctttgtgtccctggtagatggctacttccggctcacagcagatgcccat
cattacctctgcaccgacgtggcccccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgtacagaatacgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacatcctcatgaccgtcacc
tgctttgagaagtctgagcaggtgcagggtgcccagaagcagttcaagaactttcagatc
gaggtgcagaagggccgctacagtctgcacggttcggaccgcagcttccccagcttggga
gacctcatgagccacctcaagaagcagatcctgcgcacggataacatcagcttcatgcta
aaacgctgctgccagcccaagccccgagaaatctccaacctgctggtggctactaagaaa
gcccaggagtggcagcccgtctaccccatgagccagctgagtttcgatcggatcctcaag
aaggatctggtgcagggcgagcaccttgggagaggcacgagaacacacatctattctggg
accctgatggattacaaggatgacgaaggaacttctgaagagaagaagataaaagtgatc
ctcaaagtcttagaccccagccacagggatatttccctggccttcttcgaggcagccagc
atgatgagacaggtctcccacaaacacatcgtgtacctctatggcgtctgtgtccgcgac
gtggagaatatcatggtggaagagtttgtggaagggggtcctctggatctcttcatgcac
cggaaaagcgatgtccttaccacaccatggaaattcaaagttgccaaacagctggccagt
gccctgagctacttggaggataaagacctggtccatggaaatgtgtgtactaaaaacctc
ctcctggcccgtgagggcatcgacagtgagtgtggcccattcatcaagctcagtgacccc
ggcatccccattacggtgctgtctaggcaagaatgcattgaacgaatcccatggattgct
cctgagtgtgttgaggactccaagaacctgagtgtggctgctgacaagtggagctttgga
accacgctctgggaaatctgctacaatggcgagatccccttgaaagacaagacgctgatt
gagaaagagagattctatgaaagccggtgcaggccagtgacaccatcatgtaaggagctg
gctgacctcatgacccgctgcatgaactatgaccccaatcagaggcctttcttccgagcc
atcatgagagacattaataagcttgaagagcagaatccagatattgtttcagaaaaaaaa
ccagcaactgaagtggaccccacacattttgaaaagcgcttcctaaagaggatccgtgac
ttgggagagggccactttgggaaggttgagctctgcaggtatgaccccgaaggggacaat
acaggggagcaggtggctgttaaatctctgaagcctgagagtggaggtaaccacatagct
gatctgaaaaaggaaatcgagatcttaaggaacctctatcatgagaacattgtgaagtac
aaaggaatctgcacagaagacggaggaaatggtattaagctcatcatggaatttctgcct
tcgggaagccttaaggaatatcttccaaagaataagaacaaaataaacctcaaacagcag
ctaaaatatgccgttcagatttgtaaggggatggactatttgggttctcggcaatacgtt
caccgggacttggcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattgga
gacttcggtttaaccaaagcaattgaaaccgataaggagtattacaccgtcaaggatgac
cgggacagccctgtgttttggtatgctccagaatgtttaatgcaatctaaattttatatt
gcctctgacgtctggtcttttggagtcactctgcatgagctgctgacttactgtgattca
gattctagtcccatggctttgttcctgaaaatgataggcccaacccatggccagatgaca
gtcacaagacttgtgaatacgttaaaagaaggaaaacgcctgccgtgcccacctaactgt
ccagatgaggtttatcaacttatgaggaaatgctgggaattccaaccatccaatcggaca
agctttcagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system