KEGG   Homo sapiens (human): 3815Help
Entry
3815              CDS       T01001                                 

Gene name
KIT, C-Kit, CD117, PBT, SCFR
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04916  Melanogenesis
hsa05200  Pathways in cancer
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05230  Central carbon metabolism in cancer
Network
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00045  KITLG-KIT-PI3K signaling pathway
N00046  Mutation-activated KIT to PI3K signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
Disease
H00003  Acute myeloid leukemia (AML)
H00031  Breast cancer
H00170  Piebaldism
H01359  Anaphylaxis
H01511  Mast-cell leukemia
H01591  Gastrotintestinal stromal tumor
Drug target
Amuvatinib (DG01916): D09864 D09865
Ancestim: D02937
Cabozantinib (DG01670): D10062 D10095
Dasatinib (DG00714): D03658 D06414
Dovitinib lactate: D08907
Imatinib (DG00710): D01441 D08066
Masitinib: D10229
Midostaurin: D05029
Motesanib (DG01262): D06678 D08947
Nilotinib (DG00716): D06413 D08953
Pazopanib: D05380
Regorafenib (DG00720): D10137 D10138
Semaxanib: D05819
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tandutinib: D06005
Toceranib (DG01363): D08503 D08544
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3815 (KIT)
   04015 Rap1 signaling pathway
    3815 (KIT)
   04010 MAPK signaling pathway
    3815 (KIT)
   04072 Phospholipase D signaling pathway
    3815 (KIT)
   04151 PI3K-Akt signaling pathway
    3815 (KIT)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    3815 (KIT)
  Endocrine system
   04916 Melanogenesis
    3815 (KIT)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3815 (KIT)
   05230 Central carbon metabolism in cancer
    3815 (KIT)
   05221 Acute myeloid leukemia
    3815 (KIT)
   05224 Breast cancer
    3815 (KIT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3815 (KIT)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   3815 (KIT)
CD molecules [BR:hsa04090]
 Proteins
  3815 (KIT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig I-set Ig_2 Ig_4 V-set APH
Motif
Other DBs
NCBI-GeneID: 3815
NCBI-ProteinID: NP_000213
OMIM: 164920
HGNC: 6342
Ensembl: ENSG00000157404
Vega: OTTHUMG00000128713
Pharos: P10721(Tclin)
UniProt: P10721 A0A024RDA0
LinkDB All DBs
Structure
PDB: 

Position
4q12
AA seq 976 aa AA seqDB search
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcctactgcttcgcgtc
cagacaggctcttctcaaccatctgtgagtccaggggaaccgtctccaccatccatccat
ccaggaaaatcagacttaatagtccgcgtgggcgacgagattaggctgttatgcactgat
ccgggctttgtcaaatggacttttgagatcctggatgaaacgaatgagaataagcagaat
gaatggatcacggaaaaggcagaagccaccaacaccggcaaatacacgtgcaccaacaaa
cacggcttaagcaattccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaacgacacgctggtccgctgtcctctcacagac
ccagaagtgaccaattattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttattcctgaccccaaggcgggcatcatgatcaaaagtgtgaaacgcgcctaccat
cggctctgtctgcattgttctgtggaccaggagggcaagtcagtgctgtcggaaaaattc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtgtccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacgtgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagactaaactacaggagaaatataat
agctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttcagcg
agagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagcaaat
gtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgataaac
actacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaagcattc
cccaaacctgaacaccagcagtggatctatatgaacagaaccttcactgataaatgggaa
gattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatctaacg
agattaaaaggcaccgaaggaggcacttacacattcctagtgtccaattctgacgtcaat
gctgccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgacagg
ctcgtgaatggcatgctccaatgtgtggcagcaggattcccagagcccacaatagattgg
tatttttgtccaggaactgagcagagatgctctgcttctgtactgccagtggatgtgcag
acactaaactcatctgggccaccgtttggaaagctagtggttcagagttctatagattct
agtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaagact
tctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccacacc
ctgttcactcctttgctgattggtttcgtaatcgtagctggcatgatgtgcattattgtg
atgattctgacctacaaatatttacagaaacccatgtatgaagtacagtggaaggttgtt
gaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgatcac
aaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggagctttc
gggaaggttgttgaggcaactgcttatggcttaattaagtcagatgcggccatgactgtc
gctgtaaagatgctcaagccgagtgcccatttgacagaacgggaagccctcatgtctgaa
ctcaaagtcctgagttaccttggtaatcacatgaatattgtgaatctacttggagcctgc
accattggagggcccaccctggtcattacagaatattgttgctatggtgatcttttgaat
tttttgagaagaaaacgtgattcatttatttgttcaaagcaggaagatcatgcagaagct
gcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtactaatgag
tacatggacatgaaacctggagtttcttatgttgtcccaaccaaggccgacaaaaggaga
tctgtgagaataggctcatacatagaaagagatgtgactcccgccatcatggaggatgac
gagttggccctagacttagaagacttgctgagcttttcttaccaggtggcaaagggcatg
gctttcctcgcctccaagaattgtattcacagagacttggcagccagaaatatcctcctt
actcatggtcggatcacaaagatttgtgattttggtctagccagagacatcaagaatgat
tctaattatgtggttaaaggaaacgctcgactacctgtgaagtggatggcacctgaaagc
attttcaactgtgtatacacgtttgaaagtgacgtctggtcctatgggatttttctttgg
gagctgttctctttaggaagcagcccctatcctggaatgccggtcgattctaagttctac
aagatgatcaaggaaggcttccggatgctcagccctgaacacgcacctgctgaaatgtat
gacataatgaagacttgctgggatgcagatcccctaaaaagaccaacattcaagcaaatt
gttcagctaattgagaagcagatttcagagagcaccaatcatatttactccaacttagca
aactgcagccccaaccgacagaagcccgtggtagaccattctgtgcggatcaattctgtc
ggcagcaccgcttcctcctcccagcctctgcttgtgcacgacgatgtctga

DBGET integrated database retrieval system