KEGG   Homo sapiens (human): 2324
Entry
2324              CDS       T01001                                 

Gene name
FLT4, CHTD7, FLT-4, FLT41, LMPH1A, LMPHM1, PCL, VEGFR-3, VEGFR3
Definition
(RefSeq) fms related receptor tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00087  NOTCH-overexpression to Notch signaling pathway
Disease
H00535  Lymphatic malformation
H01471  Lymphangioma
Drug target
Axitinib: D03218<JP/US>
Cediranib (DG01360): D08881 D08883
Dovitinib lactate: D08907
Fruquintinib: D11977
Lenvatinib (DG01362): D09919<US> D09920<JP>
Linifanib: D09635
Lucitanib: D11762
Motesanib (DG01262): D06678 D08947
Nintedanib (DG01374): D10396<JP/US> D10481
Pazopanib: D05380<JP/US>
Regorafenib (DG00720): D10137<JP/US> D10138
Selpercatinib: D11713<US>
Sitravatinib (DG03045): D11140 D11541
Sorafenib (DG00713): D06272<JP/US> D08524
Sunitinib (DG00712): D06402<JP/US> D08552
Surufatinib: D11885
Tesevatinib (DG03101): D11772 D11773
Tivozanib (DG01375): D09683 D10190
Vatalanib: D06285
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2324 (FLT4)
   04014 Ras signaling pathway
    2324 (FLT4)
   04015 Rap1 signaling pathway
    2324 (FLT4)
   04020 Calcium signaling pathway
    2324 (FLT4)
   04151 PI3K-Akt signaling pathway
    2324 (FLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2324 (FLT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2324 (FLT4)
  09162 Cancer: specific types
   05224 Breast cancer
    2324 (FLT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2324 (FLT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2324 (FLT4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   2324 (FLT4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Ig_2 Pkinase ig VEGFR-2_TMD V-set Ig_6 C1-set TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 2324
NCBI-ProteinID: NP_891555
OMIM: 136352
HGNC: 3767
Ensembl: ENSG00000037280
Vega: OTTHUMG00000130931
Pharos: P35916(Tclin)
UniProt: P35916
LinkDB
Structure
PDB: 
4BSJ 4BSK

Position
5q35.3
AA seq 1363 aa
MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQ
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRR
RPERGARGGQVFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcagcggggcgccgcgctgtgcctgcgactgtggctctgcctgggactcctggacggc
ctggtgagtggctactccatgacccccccgaccttgaacatcacggaggagtcacacgtc
atcgacaccggtgacagcctgtccatctcctgcaggggacagcaccccctcgagtgggct
tggccaggagctcaggaggcgccagccaccggagacaaggacagcgaggacacgggggtg
gtgcgagactgcgagggcacagacgccaggccctactgcaaggtgttgctgctgcacgag
gtacatgccaacgacacaggcagctacgtctgctactacaagtacatcaaggcacgcatc
gagggcaccacggccgccagctcctacgtgttcgtgagagactttgagcagccattcatc
aacaagcctgacacgctcttggtcaacaggaaggacgccatgtgggtgccctgtctggtg
tccatccccggcctcaatgtcacgctgcgctcgcaaagctcggtgctgtggccagacggg
caggaggtggtgtgggatgaccggcggggcatgctcgtgtccacgccactgctgcacgat
gccctgtacctgcagtgcgagaccacctggggagaccaggacttcctttccaaccccttc
ctggtgcacatcacaggcaacgagctctatgacatccagctgttgcccaggaagtcgctg
gagctgctggtaggggagaagctggtcctgaactgcaccgtgtgggctgagtttaactca
ggtgtcacctttgactgggactacccagggaagcaggcagagcggggtaagtgggtgccc
gagcgacgctcccagcagacccacacagaactctccagcatcctgaccatccacaacgtc
agccagcacgacctgggctcgtatgtgtgcaaggccaacaacggcatccagcgatttcgg
gagagcaccgaggtcattgtgcatgaaaatcccttcatcagcgtcgagtggctcaaagga
cccatcctggaggccacggcaggagacgagctggtgaagctgcccgtgaagctggcagcg
taccccccgcccgagttccagtggtacaaggatggaaaggcactgtccgggcgccacagt
ccacatgccctggtgctcaaggaggtgacagaggccagcacaggcacctacaccctcgcc
ctgtggaactccgctgctggcctgaggcgcaacatcagcctggagctggtggtgaatgtg
cccccccagatacatgagaaggaggcctcctcccccagcatctactcgcgtcacagccgc
caggccctcacctgcacggcctacggggtgcccctgcctctcagcatccagtggcactgg
cggccctggacaccctgcaagatgtttgcccagcgtagtctccggcggcggcagcagcaa
gacctcatgccacagtgccgtgactggagggcggtgaccacgcaggatgccgtgaacccc
atcgagagcctggacacctggaccgagtttgtggagggaaagaataagactgtgagcaag
ctggtgatccagaatgccaacgtgtctgccatgtacaagtgtgtggtctccaacaaggtg
ggccaggatgagcggctcatctacttctatgtgaccaccatccccgacggcttcaccatc
gaatccaagccatccgaggagctactagagggccagccggtgctcctgagctgccaagcc
gacagctacaagtacgagcatctgcgctggtaccgcctcaacctgtccacgctgcacgat
gcgcacgggaacccgcttctgctcgactgcaagaacgtgcatctgttcgccacccctctg
gccgccagcctggaggaggtggcacctggggcgcgccacgccacgctcagcctgagtatc
ccccgcgtcgcgcccgagcacgagggccactatgtgtgcgaagtgcaagaccggcgcagc
catgacaagcactgccacaagaagtacctgtcggtgcaggccctggaagcccctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagcgactcgctggagatgcagtgcttg
gtggccggagcgcacgcgcccagcatcgtgtggtacaaagacgagaggctgctggaggaa
aagtctggagtcgacttggcggactccaaccagaagctgagcatccagcgcgtgcgcgag
gaggatgcgggacgctatctgtgcagcgtgtgcaacgccaagggctgcgtcaactcctcc
gccagcgtggccgtggaaggctccgaggataagggcagcatggagatcgtgatccttgtc
ggtaccggcgtcatcgctgtcttcttctgggtcctcctcctcctcatcttctgtaacatg
aggaggccggcccacgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctctggaggagcaatgcgaatacctgtcctacgatgccagccagtgggaattc
ccccgagagcggctgcacctggggagagtgctcggctacggcgccttcgggaaggtggtg
gaagcctccgctttcggcatccacaagggcagcagctgtgacaccgtggccgtgaaaatg
ctgaaagagggcgccacggccagcgagcaccgcgcgctgatgtcggagctcaagatcctc
attcacatcggcaaccacctcaacgtggtcaacctcctcggggcgtgcaccaagccgcag
ggccccctcatggtgatcgtggagttctgcaagtacggcaacctctccaacttcctgcgc
gccaagcgggacgccttcagcccctgcgcggagaagtctcccgagcagcgcggacgcttc
cgcgccatggtggagctcgccaggctggatcggaggcggccggggagcagcgacagggtc
ctcttcgcgcggttctcgaagaccgagggcggagcgaggcgggcttctccagaccaagaa
gctgaggacctgtggctgagcccgctgaccatggaagatcttgtctgctacagcttccag
gtggccagagggatggagttcctggcttcccgaaagtgcatccacagagacctggctgct
cggaacattctgctgtcggaaagcgacgtggtgaagatctgtgactttggccttgcccgg
gacatctacaaagaccccgactacgtccgcaagggcagtgcccggctgcccctgaagtgg
atggcccctgaaagcatcttcgacaaggtgtacaccacgcagagtgacgtgtggtccttt
ggggtgcttctctgggagatcttctctctgggggcctccccgtaccctggggtgcagatc
aatgaggagttctgccagcggctgagagacggcacaaggatgagggccccggagctggcc
actcccgccatacgccgcatcatgctgaactgctggtccggagaccccaaggcgagacct
gcattctcggagctggtggagatcctgggggacctgctccagggcaggggcctgcaagag
gaagaggaggtctgcatggccccgcgcagctctcagagctcagaagagggcagcttctcg
caggtgtccaccatggccctacacatcgcccaggctgacgctgaggacagcccgccaagc
ctgcagcgccacagcctggccgccaggtattacaactgggtgtcctttcccgggtgcctg
gccagaggggctgagacccgtggttcctccaggatgaagacatttgaggaattccccatg
accccaacgacctacaaaggctctgtggacaaccagacagacagtgggatggtgctggcc
tcggaggagtttgagcagatagagagcaggcatagacaagaaagcggcttcagctgtaaa
ggacctggccagaatgtggctgtgaccagggcacaccctgactcccaagggaggcggcgg
cggcctgagcggggggcccgaggaggccaggtgttttacaacagcgagtatggggagctg
tcggagccaagcgaggaggaccactgctccccgtctgcccgcgtgactttcttcacagac
aacagctactaa

DBGET integrated database retrieval system