KEGG   COMPOUND: C00017
Entry
C00017                      Compound                               
Name
Protein
Formula
C2H4NO2R(C2H2NOR)n
Structure
Comment
Generic compound in reaction hierarchy
Reaction
Pathway
map00450  Selenocompound metabolism
map05022  Pathways of neurodegeneration - multiple diseases
Enzyme
2.3.2.6         2.3.2.8         2.4.1.113       2.7.11.1        
2.7.11.8        2.7.11.9        2.7.11.10       2.7.11.11       
2.7.11.12       2.7.11.13       2.7.11.17       2.7.11.21       
2.7.11.22       2.7.11.24       2.7.11.25       2.7.11.30       
2.7.12.1        2.7.12.2        3.1.2.22        3.1.3.16        
3.4.-.-
Other DBs
PubChem: 3319
ChEBI: 16541
LinkDB
KCF data

ATOM        11
            1   N1a N    23.5200  -21.2800
            2   C1c C    24.7100  -20.5800
            3   C5a C    25.9700  -21.2800
            4   N1b N    27.1600  -20.5800
            5   O5a O    25.9700  -22.6800
            6   C1c C    28.3500  -21.2800
            7   R   R    28.3500  -22.6800
            8   C6a C    29.6100  -20.5800
            9   O6a O    29.6100  -19.1800
            10  O6a O    30.8000  -21.2800
            11  R   R    24.7100  -19.1800
BOND        10
            1     1   2 1
            2     2   3 1
            3     3   4 1
            4     3   5 2
            5     4   6 1
            6     6   7 1 #Down
            7     6   8 1
            8     8   9 2
            9     8  10 1
            10    2  11 1 #Up
BRACKET     1    25.8300  -23.5900   25.8300  -19.1100
            1    28.4900  -19.1100   28.4900  -23.5900
            1  n
 ORIGINAL  1    3   4   5   6   7
 REPEAT    1

» Japanese version

KEGG   Homo sapiens (human): 6233
Entry
6233              CDS       T01001                                 
Symbol
RPS27A, CEP80, HEL112, S27A, UBA80, UBC, UBCEP1, UBCEP80
Name
(RefSeq) ribosomal protein S27a
  KO
K02977  ubiquitin-small subunit ribosomal protein S27Ae
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01317  Translation initiation
N01318  SARS-CoV-2 nsp1 to translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6233 (RPS27A)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6233 (RPS27A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    6233 (RPS27A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6233 (RPS27A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6233 (RPS27A)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    6233 (RPS27A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    6233 (RPS27A)
   05022 Pathways of neurodegeneration - multiple diseases
    6233 (RPS27A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6233 (RPS27A)
   04121 Ubiquitin system [BR:hsa04121]
    6233 (RPS27A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    6233 (RPS27A)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    6233 (RPS27A)
  Archaea
    6233 (RPS27A)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   6233 (RPS27A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6233 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   6233 (RPS27A)
SSDB
Motif
Pfam: ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Dsc3_N Ubiquitin_5 DUF2604
Other DBs
NCBI-GeneID: 6233
NCBI-ProteinID: NP_001129064
OMIM: 191343
HGNC: 10417
Ensembl: ENSG00000143947
Pharos: P62979(Tbio)
UniProt: P62979 B2RDW1
Structure
LinkDB
Position
2:55231903..55235853
AA seq 156 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaggttgaaccctcg
gatacgatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag
cagagactgatctttgctggcaagcagctggaagatggacgtactttgtctgactacaat
attcaaaaggagtctactcttcatcttgtgttgagacttcgtggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctg
gctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagag
tgcccttctgatgaatgtggtgctggggtgtttatggcaagtcactttgacagacattat
tgtggcaaatgttgtctgacttactgtttcaacaaaccagaagacaagtaa

KEGG   Homo sapiens (human): 7311
Entry
7311              CDS       T01001                                 
Symbol
UBA52, CEP52, HUBCEP52, L40, RPL40
Name
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01317  Translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    7311 (UBA52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7311 (UBA52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7311 (UBA52)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    7311 (UBA52)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7311 (UBA52)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7311 (UBA52)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7311 (UBA52)
   05022 Pathways of neurodegeneration - multiple diseases
    7311 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    7311 (UBA52)
   04121 Ubiquitin system [BR:hsa04121]
    7311 (UBA52)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    7311 (UBA52)
  Archaea
    7311 (UBA52)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7311 (UBA52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 7311
NCBI-ProteinID: NP_001029102
OMIM: 191321
HGNC: 12458
Ensembl: ENSG00000221983
Pharos: P62987(Tbio)
UniProt: P62987 Q3MIH3 Q7Z4P3
Structure
LinkDB
Position
19:18563766..18577550
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctcactggcaaaaccatcacccttgaggtcgagcccagt
gacaccattgagaatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag
cagcgtctgatatttgccggcaaacagctggaggatggccgcactctctcagactacaac
atccagaaagagtccaccctgcacctggtgttgcgcctgcgaggtggcattattgagcct
tctctccgccagcttgcccagaaatacaactgcgacaagatgatctgccgcaagtgctat
gctcgccttcaccctcgtgctgtcaactgccgcaagaagaagtgtggtcacaccaacaac
ctgcgtcccaagaagaaggtcaaataa

KEGG   Homo sapiens (human): 7314
Entry
7314              CDS       T01001                                 
Symbol
UBB, HEL-S-50
Name
(RefSeq) ubiquitin B
  KO
K04551  ubiquitin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7314 (UBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7314 (UBB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7314 (UBB)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7314 (UBB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7314 (UBB)
   05022 Pathways of neurodegeneration - multiple diseases
    7314 (UBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7314 (UBB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7314 (UBB)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7314 (UBB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7314 (UBB)
  Exosomal proteins of other body fluids (saliva and urine)
   7314 (UBB)
  Exosomal proteins of colorectal cancer cells
   7314 (UBB)
  Exosomal proteins of bladder cancer cells
   7314 (UBB)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N
Other DBs
NCBI-GeneID: 7314
NCBI-ProteinID: NP_001268645
OMIM: 191339
HGNC: 12463
Ensembl: ENSG00000170315
Pharos: P0CG47(Tbio)
UniProt: P0CG47 Q5U5U6
Structure
LinkDB
Position
17:16380779..16382745
AA seq 229 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagt
gacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcattccccccgaccag
cagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaac
atccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttc
gtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgaa
aatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatc
tttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggag
tcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctg
accggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggcc
aagatccaagataaagaaggcatcccccccgaccagcagaggctcatctttgcaggcaag
cagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcac
ctggtcctgcgcctgaggggtggctgttaa

KEGG   Homo sapiens (human): 7316
Entry
7316              CDS       T01001                                 
Symbol
UBC, HMG20
Name
(RefSeq) ubiquitin C
  KO
K08770  ubiquitin C
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7316 (UBC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7316 (UBC)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    7316 (UBC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7316 (UBC)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7316 (UBC)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7316 (UBC)
   05022 Pathways of neurodegeneration - multiple diseases
    7316 (UBC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7316 (UBC)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7316 (UBC)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5
Other DBs
NCBI-GeneID: 7316
NCBI-ProteinID: NP_066289
OMIM: 191340
HGNC: 12468
Ensembl: ENSG00000150991
Pharos: P0CG48(Tbio)
UniProt: P0CG48
Structure
LinkDB
Position
12:complement(124911646..124914650)
AA seq 685 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagactctgactggtaagaccatcaccctcgaggttgagcccagt
gacaccatcgagaatgtcaaggcaaagatccaagataaggaaggcatccctcctgaccag
cagaggctgatctttgctggaaaacagctggaagatgggcgcaccctgtctgactacaac
atccagaaagagtccaccctgcacctggtgctccgtctcagaggtgggatgcaaatcttc
gtgaagacactcactggcaagaccatcacccttgaggtcgagcccagtgacaccatcgag
aacgtcaaagcaaagatccaggacaaggaaggcattcctcctgaccagcagaggttgatc
tttgccggaaagcagctggaagatgggcgcaccctgtctgactacaacatccagaaagag
tctaccctgcacctggtgctccgtctcagaggtgggatgcagatcttcgtgaagaccctg
actggtaagaccatcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggca
aagatccaagataaggaaggcattcctcctgatcagcagaggttgatctttgccggaaaa
cagctggaagatggtcgtaccctgtctgactacaacatccagaaagagtccaccttgcac
ctggtactccgtctcagaggtgggatgcaaatcttcgtgaagacactcactggcaagacc
atcacccttgaggtcgagcccagtgacactatcgagaacgtcaaagcaaagatccaagac
aaggaaggcattcctcctgaccagcagaggttgatctttgccggaaagcagctggaagat
gggcgcaccctgtctgactacaacatccagaaagagtctaccctgcacctggtgctccgt
ctcagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaa
gtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatc
cctcctgaccagcagaggttgatctttgccggaaaacagctggaagatggtcgtaccctg
tctgactacaacatccagaaagagtccaccttgcacctggtgctccgtctcagaggtggg
atgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaggtggagccgagt
gacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccag
cagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaac
atccagaaagagtccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttc
gtgaagaccctgactggtaagaccatcactctcgaagtggagccgagtgacaccattgag
aatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatc
tttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagag
tccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttcgtgaagaccctg
actggtaagaccatcactctcgaagtggagccgagtgacaccattgagaatgtcaaggca
aagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgctgggaaa
cagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccaccctgcac
ctggtgctccgtctcagaggtgggatgcaaatcttcgtgaagaccctgactggtaagacc
atcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggcaaagatccaagat
aaggaaggcatccctcctgatcagcagaggttgatctttgctgggaaacagctggaagat
ggacgcaccctgtctgactacaacatccagaaagagtccactctgcacttggtcctgcgc
ttgagggggggtgtctaa

DBGET integrated database retrieval system