KEGG   Homo sapiens (human): 3383Help
Entry
3383              CDS       T01001                                 

Gene name
ICAM1, BB2, CD54, P3.58
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05150  Staphylococcus aureus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06229  MHC presentation
  Element
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Disease
H00083  Allograft rejection
Drug target
Alicaforsen sodium: D02811
Enlimomab: D04000
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3383 (ICAM1)
   04668 TNF signaling pathway
    3383 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3383 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3383 (ICAM1)
   04670 Leukocyte transendothelial migration
    3383 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    3383 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3383 (ICAM1)
   05416 Viral myocarditis
    3383 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    3383 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3383 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3383 (ICAM1)
   05164 Influenza A
    3383 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3383 (ICAM1)
   05169 Epstein-Barr virus infection
    3383 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    3383 (ICAM1)
   05143 African trypanosomiasis
    3383 (ICAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3383 (ICAM1)
   04090 CD molecules [BR:hsa04090]
    3383 (ICAM1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3383 (ICAM1)
   04091 Lectins [BR:hsa04091]
    3383 (ICAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3383 (ICAM1)
CD molecules [BR:hsa04090]
 Proteins
  3383 (ICAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   3383 (ICAM1)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  3383 (ICAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig C2-set_2 Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 3383
NCBI-ProteinID: NP_000192
OMIM: 147840
HGNC: 5344
Ensembl: ENSG00000090339
Vega: OTTHUMG00000180403
Pharos: P05362(Tchem)
UniProt: P05362 A0A384MEK5
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 532 aa AA seqDB search
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctcccagcagcccccggcccgcgctgcccgcactcctggtcctgctcggggctctg
ttcccaggacctggcaatgcccagacatctgtgtccccctcaaaagtcatcctgccccgg
ggaggctccgtgctggtgacatgcagcacctcctgtgaccagcccaagttgttgggcata
gagaccccgttgcctaaaaaggagttgctcctgcctgggaacaaccggaaggtgtatgaa
ctgagcaatgtgcaagaagatagccaaccaatgtgctattcaaactgccctgatgggcag
tcaacagctaaaaccttcctcaccgtgtactggactccagaacgggtggaactggcaccc
ctcccctcttggcagccagtgggcaagaaccttaccctacgctgccaggtggagggtggg
gcaccccgggccaacctcaccgtggtgctgctccgtggggagaaggagctgaaacgggag
ccagctgtgggggagcccgctgaggtcacgaccacggtgctggtgaggagagatcaccat
ggagccaatttctcgtgccgcactgaactggacctgcggccccaagggctggagctgttt
gagaacacctcggccccctaccagctccagacctttgtcctgccagcgactcccccacaa
cttgtcagcccccgggtcctagaggtggacacgcaggggaccgtggtctgttccctggac
gggctgttcccagtctcggaggcccaggtccacctggcactgggggaccagaggttgaac
cccacagtcacctatggcaacgactccttctcggccaaggcctcagtcagtgtgaccgca
gaggacgagggcacccagcggctgacgtgtgcagtaatactggggaaccagagccaggag
acactgcagacagtgaccatctacagctttccggcgcccaacgtgattctgacgaagcca
gaggtctcagaagggaccgaggtgacagtgaagtgtgaggcccaccctagagccaaggtg
acgctgaatggggttccagcccagccactgggcccgagggcccagctcctgctgaaggcc
accccagaggacaacgggcgcagcttctcctgctctgcaaccctggaggtggccggccag
cttatacacaagaaccagacccgggagcttcgtgtcctgtatggcccccgactggacgag
agggattgtccgggaaactggacgtggccagaaaattcccagcagactccaatgtgccag
gcttgggggaacccattgcccgagctcaagtgtctaaaggatggcactttcccactgccc
atcggggaatcagtgactgtcactcgagatcttgagggcacctacctctgtcgggccagg
agcactcaaggggaggtcacccgcaaggtgaccgtgaatgtgctctccccccggtatgag
attgtcatcatcactgtggtagcagccgcagtcataatgggcactgcaggcctcagcacg
tacctctataaccgccagcggaagatcaagaaatacagactacaacaggcccaaaaaggg
acccccatgaaaccgaacacacaagccacgcctccctga

KEGG   Homo sapiens (human): 942Help
Entry
942               CDS       T01001                                 

Gene name
CD86, B7-2, B7.2, B70, CD28LG2, LAB72
Definition
(RefSeq) CD86 molecule
  KO
K05413  CD86 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06114  PI3K signaling (viruses)
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06169  Measles virus (MV)
nt06229  MHC presentation
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
N00185  KSHV MIR2 to cell surface molecule-endocytosis
N00683  CD80/CD86-CD28-PI3K signaling pathway
Drug target
Abatacept: D03203
Belatacept: D03222
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    942 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    942 (CD86)
   04672 Intestinal immune network for IgA production
    942 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    942 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    942 (CD86)
   05323 Rheumatoid arthritis
    942 (CD86)
   05320 Autoimmune thyroid disease
    942 (CD86)
   05330 Allograft rejection
    942 (CD86)
   05332 Graft-versus-host disease
    942 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    942 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    942 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    942 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    942 (CD86)
   04090 CD molecules [BR:hsa04090]
    942 (CD86)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   942 (CD86)
CD molecules [BR:hsa04090]
 Proteins
  942 (CD86)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 V-set Ig_3 LAX I-set ig DUF4381 C2-set_2 MAP17 DUF2681
Motif
Other DBs
NCBI-GeneID: 942
NCBI-ProteinID: NP_787058
OMIM: 601020
HGNC: 1705
Ensembl: ENSG00000114013
Vega: OTTHUMG00000159482
Pharos: P42081(Tclin)
UniProt: P42081 A8K632
LinkDB All DBs
Structure
PDB: 

Position
3q13.33
AA seq 329 aa AA seqDB search
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatccccagtgcactatgggactgagtaacattctctttgtgatggccttcctgctc
tctggtgctgctcctctgaagattcaagcttatttcaatgagactgcagacctgccatgc
caatttgcaaactctcaaaaccaaagcctgagtgagctagtagtattttggcaggaccag
gaaaacttggttctgaatgaggtatacttaggcaaagagaaatttgacagtgttcattcc
aagtatatgggccgcacaagttttgattcggacagttggaccctgagacttcacaatctt
cagatcaaggacaagggcttgtatcaatgtatcatccatcacaaaaagcccacaggaatg
attcgcatccaccagatgaattctgaactgtcagtgcttgctaacttcagtcaacctgaa
atagtaccaatttctaatataacagaaaatgtgtacataaatttgacctgctcatctata
cacggttacccagaacctaagaagatgagtgttttgctaagaaccaagaattcaactatc
gagtatgatggtgttatgcagaaatctcaagataatgtcacagaactgtacgacgtttcc
atcagcttgtctgtttcattccctgatgttacgagcaatatgaccatcttctgtattctg
gaaactgacaagacgcggcttttatcttcacctttctctatagagcttgaggaccctcag
cctcccccagaccacattccttggattacagctgtacttccaacagttattatatgtgtg
atggttttctgtctaattctatggaaatggaagaagaagaagcggcctcgcaactcttat
aaatgtggaaccaacacaatggagagggaagagagtgaacagaccaagaaaagagaaaaa
atccatatacctgaaagatctgatgaagcccagcgtgtttttaaaagttcgaagacatct
tcatgcgacaaaagtgatacatgtttttaa

KEGG   Homo sapiens (human): 100507436Help
Entry
100507436         CDS       T01001                                 

Gene name
MICA, MIC-A, PERB11.1
Definition
(RefSeq) MHC class I polypeptide-related sequence A
  KO
K07985  MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06229  MHC presentation
  Element
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Disease
H00288  Familial Mediterranean fever
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100507436 (MICA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100507436 (MICA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 TDH Ig_2
Motif
Other DBs
NCBI-GeneID: 100507436
NCBI-ProteinID: NP_000238
OMIM: 600169
HGNC: 7090
Ensembl: ENSG00000204520
Vega: OTTHUMG00000031073
Pharos: Q29983(Tbio)
UniProt: Q29983
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 383 aa AA seqDB search
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCD
RQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCE
IHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHY
HAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHR
DATQLGFQPLMSDLGSTGSTEGA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggcccggtcttcctgcttctggctggcatcttcccttttgcacctccggga
gctgctgctgagccccacagtcttcgttataacctcacggtgctgtcctgggatggatct
gtgcagtcagggtttctcactgaggtacatctggatggtcagcccttcctgcgctgtgac
aggcagaaatgcagggcaaagccccagggacagtgggcagaagatgtcctgggaaataag
acatgggacagagagaccagagacttgacagggaacggaaaggacctcaggatgaccctg
gctcatatcaaggaccagaaagaaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacaacagcaccaggagctcccagcatttctactacgatggggagctcttc
ctctcccaaaacctggagactaaggaatggacaatgccccagtcctccagagctcagacc
ttggccatgaacgtcaggaatttcttgaaggaagatgccatgaagaccaagacacactat
cacgctatgcatgcagactgcctgcaggaactacggcgatatctaaaatccggcgtagtc
ctgaggagaacagtgccccccatggtgaatgtcacccgcagcgaggcctcagagggcaac
attaccgtgacatgcagggcttctggcttctatccctggaatatcacactgagctggcgt
caggatggggtatctttgagccacgacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggatttgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacagcactcaccctgtgccctctgggaaagtg
ctggtgcttcagagtcattggcagacattccatgtttctgctgttgctgctgctgctatt
tttgttattattattttctatgtccgttgttgtaagaagaaaacatcagctgcagagggt
ccagagctcgtgagcctgcaggtcctggatcaacacccagttgggacgagtgaccacagg
gatgccacacagctcggatttcagcctctgatgtcagatcttgggtccactggctccact
gagggcgcctag

KEGG   Homo sapiens (human): 4277Help
Entry
4277              CDS       T01001                                 

Gene name
MICB, PERB11.2
Definition
(RefSeq) MHC class I polypeptide-related sequence B
  KO
K07985  MHC class I-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06229  MHC presentation
  Element
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    4277 (MICB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    4277 (MICB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2
Motif
Other DBs
NCBI-GeneID: 4277
NCBI-ProteinID: NP_005922
OMIM: 602436
HGNC: 7091
Ensembl: ENSG00000204516
Vega: OTTHUMG00000031074
Pharos: Q29980(Tbio)
UniProt: Q29980 X6R344
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 383 aa AA seqDB search
MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYD
RQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCE
IHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHY
RAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWR
QDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKA
LVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHR
DAAQLGFQPLMSATGSTGSTEGT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggccgggtcctgctgtttctggccgtcgccttcccttttgcacccccggca
gccgccgctgagccccacagtcttcgttacaacctcatggtgctgtcccaggatggatct
gtgcagtcagggtttctcgctgagggacatctggatggtcagcccttcctgcgctatgac
aggcagaaacgcagggcaaagccccagggacagtgggcagaaaatgtcctgggagctaag
acctgggacacagagaccgaggacttgacagagaatgggcaagacctcaggaggaccctg
actcatatcaaggaccagaaaggaggcttgcattccctccaggagattagggtctgtgag
atccatgaagacagcagcaccaggggctcccggcatttctactacgatggggagctcttc
ctctcccaaaacctggagactcaagaatcgacagtgccccagtcctccagagctcagacc
ttggctatgaacgtcacaaatttctggaaggaagatgccatgaagaccaagacacactat
cgcgctatgcaggcagactgcctgcagaaactacagcgatatctgaaatccggggtggcc
atcaggagaacagtgccccccatggtgaatgtcacctgcagcgaggtctcagagggcaac
atcaccgtgacatgcagggcttccagcttctatccccggaatatcacactgacctggcgt
caggatggggtatctttgagccacaacacccagcagtggggggatgtcctgcctgatggg
aatggaacctaccagacctgggtggccaccaggattcgccaaggagaggagcagaggttc
acctgctacatggaacacagcgggaatcacggcactcaccctgtgccctctgggaaggcg
ctggtgcttcagagtcaacggacagactttccatatgtttctgctgctatgccatgtttt
gttattattattattctctgtgtcccttgttgcaagaagaaaacatcagcggcagagggt
ccagagcttgtgagcctgcaggtcctggatcaacacccagttgggacaggagaccacagg
gatgcagcacagctgggatttcagcctctgatgtcagctactgggtccactggttccact
gagggcacctag

KEGG   Homo sapiens (human): 9976Help
Entry
9976              CDS       T01001                                 

Gene name
CLEC2B, AICL, CLECSF2, HP10085, IFNRG1
Definition
(RefSeq) C-type lectin domain family 2 member B
  KO
K10071  C-type lectin domain family 2 member B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06229  MHC presentation
  Element
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    9976 (CLEC2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    9976 (CLEC2B)
   04091 Lectins [BR:hsa04091]
    9976 (CLEC2B)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   9976 (CLEC2B)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   9976 (CLEC2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45
Motif
Other DBs
NCBI-GeneID: 9976
NCBI-ProteinID: NP_005118
OMIM: 603242
HGNC: 2053
Ensembl: ENSG00000110852
Vega: OTTHUMG00000168483
Pharos: Q92478(Tbio)
UniProt: Q92478
LinkDB All DBs
Position
12p13.31
AA seq 149 aa AA seqDB search
MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSK
YNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGS
EGCAYLSDDGAATARCYTERKWICRKRIH
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaaacataaaaagtgttttataattgttggtgttttaataacaactaatatt
attactctgatagttaaactaactcgagattctcagagtttatgcccctatgattggatt
ggtttccaaaacaaatgctattatttctctaaagaagaaggagattggaattcaagtaaa
tacaactgttccactcaacatgccgacctaactataattgacaacatagaagaaatgaat
tttcttaggcggtataaatgcagttctgatcactggattggactgaagatggcaaaaaat
cgaacaggacaatgggtagatggagctacatttaccaaatcgtttggcatgagagggagt
gaaggatgtgcctacctcagcgatgatggtgcagcaacagctagatgttacaccgaaaga
aaatggatttgcaggaaaagaatacactaa

KEGG   Homo sapiens (human): 3459Help
Entry
3459              CDS       T01001                                 

Gene name
IFNGR1, CD119, IFNGR, IMD27A, IMD27B
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (viruses)
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06229  MHC presentation
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00185  KSHV MIR2 to cell surface molecule-endocytosis
Disease
H00089  IFN-gamma/IL-12 axis
H00342  Tuberculosis
Drug target
Interferon gamma (DG00737): D00747 D03357 D08805
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3459 (IFNGR1)
   04066 HIF-1 signaling pathway
    3459 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3459 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3459 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3459 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    3459 (IFNGR1)
   04659 Th17 cell differentiation
    3459 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3459 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3459 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3459 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3459 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3459 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    3459 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    3459 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3459 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3459 (IFNGR1)
   05140 Leishmaniasis
    3459 (IFNGR1)
   05142 Chagas disease (American trypanosomiasis)
    3459 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3459 (IFNGR1)
   04090 CD molecules [BR:hsa04090]
    3459 (IFNGR1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IFN receptor family
   3459 (IFNGR1)
CD molecules [BR:hsa04090]
 Proteins
  3459 (IFNGR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 3459
NCBI-ProteinID: NP_000407
OMIM: 107470
HGNC: 5439
Ensembl: ENSG00000027697
Vega: OTTHUMG00000015656
Pharos: P15260(Tbio)
UniProt: P15260 A0A0S2Z3Y2
LinkDB All DBs
Structure
PDB: 

Position
6q23.3
AA seq 489 aa AA seqDB search
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVFICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPFSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDVVPGSHLTPIERESSSPLSSNQSEPGSIALNSYHSRNCSESDHSRNGFDTDSSCLE
SHSSLSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYR
PTEDSKEFS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctctttctcctaccccttgtcatgcagggtgtgagcagggctgagatgggc
accgcggatctggggccgtcctcagtgcctacaccaactaatgttacaattgaatcctat
aacatgaaccctatcgtatattgggagtaccagatcatgccacaggtccctgtttttacc
gtagaggtaaagaactatggtgttaagaattcagaatggattgatgcctgcatcaatatt
tctcatcattattgtaatatttctgatcatgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcaaagtcagaagaatttgct
gtatgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatgattgacatatttcacccttcagtttttgtaaatggagacgagcaggaagtcgat
tatgatcccgaaactacctgttacattagggtgtacaatgtgtatgtgagaatgaacgga
agtgagatccagtataaaatactcacgcagaaggaagatgattgtgacgagattcagtgc
cagttagcgattccagtatcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtgtggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcagtataaaaggttctctttggattccagttgttgctgctttactactctttctagtg
cttagcctggtattcatctgtttttatattaagaaaattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtaagaagtgctactttagagacaaaacct
gaatcaaaatatgtatcactcatcacgtcataccagccattttccttagaaaaggaggtg
gtctgtgaagagccgttgtctccagcaacagttccaggcatgcataccgaagacaatcca
ggaaaagtggaacatacagaagaactttctagtataacagaagtggtgactactgaagaa
aatattcctgacgtggtcccgggcagccatctgactccaatagagagagagagttcttca
cctttaagtagtaaccagtctgaacctggcagcatcgctttaaactcgtatcactccaga
aattgttctgagagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacatagctccttatctgactcagaatttcccccaaataataaaggtgaaataaaaaca
gaaggacaagagctcataaccgtaataaaagcccccacctcctttggttatgataaacca
catgtgctagtggatctacttgtggatgatagcggtaaagagtccttgattggttataga
ccaacagaagattccaaagaattttcatga

DBGET integrated database retrieval system