KEGG   Homo sapiens (human): 916Help
Entry
916               CDS       T01001                                 

Gene name
CD3E, IMD18, T3E, TCRE
Definition
(RefSeq) CD3e molecule
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Antithymocyte immunoglobulin (rabbit): D09190
Blinatumomab: D09325
Catumaxomab: D09207
Cibisatamab: D11489
Duvortuxizumab: D11372
Flotetuzumab: D11306
Mosunetuzumab: D11463
Muromonab-CD3: D05092
Odronextamab: D11534
Otelixizumab: D08959
Teplizumab: D09013
Visilizumab: D06314
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    916 (CD3E)
   04660 T cell receptor signaling pathway
    916 (CD3E)
   04658 Th1 and Th2 cell differentiation
    916 (CD3E)
   04659 Th17 cell differentiation
    916 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    916 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    916 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    916 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    916 (CD3E)
   05162 Measles
    916 (CD3E)
   05169 Epstein-Barr virus infection
    916 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    916 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    916 (CD3E)
CD molecules [BR:hsa04090]
 Proteins
  916 (CD3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_3 Ig_2 P5-ATPase
Motif
Other DBs
NCBI-GeneID: 916
NCBI-ProteinID: NP_000724
OMIM: 186830
HGNC: 1674
Ensembl: ENSG00000198851
Vega: OTTHUMG00000166968
Pharos: P07766(Tclin)
UniProt: P07766
LinkDB All DBs
Structure
PDB: 

Position
11q23.3
AA seq 207 aa AA seqDB search
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ
HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE
NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP
PPVPNPDYEPIRKGQRDLYSGLNQRRI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgggcactcactggagagttctgggcctctgcctcttatcagttggcgtttgg
gggcaagatggtaatgaagaaatgggtggtattacacagacaccatataaagtctccatc
tctggaaccacagtaatattgacatgccctcagtatcctggatctgaaatactatggcaa
cacaatgataaaaacataggcggtgatgaggatgataaaaacataggcagtgatgaggat
cacctgtcactgaaggaattttcagaattggagcaaagtggttattatgtctgctacccc
agaggaagcaaaccagaagatgcgaacttttatctctacctgagggcaagagtgtgtgag
aactgcatggagatggatgtgatgtcggtggccacaattgtcatagtggacatctgcatc
actgggggcttgctgctgctggtttactactggagcaagaatagaaaggccaaggccaag
cctgtgacacgaggagcgggtgctggcggcaggcaaaggggacaaaacaaggagaggcca
ccacctgttcccaacccagactatgagcccatccggaaaggccagcgggacctgtattct
ggcctgaatcagagacgcatctga

DBGET integrated database retrieval system