KEGG   Homo sapiens (human): 355
Entry
355               CDS       T01001                                 
Symbol
FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Name
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease
hsa04936  Alcoholic liver disease
hsa04940  Type I diabetes mellitus
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05417  Lipid and atherosclerosis
Network
nt06131  Apoptosis (viruses and bacteria)
nt06140  Transcription (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
nt06414  Apoptosis
nt06460  Alzheimer disease
nt06463  Parkinson disease
  Element
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00448  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
N00535  HBV HBx to p53-mediated transcription
N01005  Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways
N01056  FAS-JNK signaling pathway
Disease
H00005  Chronic lymphocytic leukemia
H00007  Hodgkin lymphoma
H00009  Adult T-cell leukemia
H00017  Esophageal cancer
H00108  Autoimmune lymphoproliferative syndromes
H01463  Mycosis fungoides
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    355 (FAS)
   04668 TNF signaling pathway
    355 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    355 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    355 (FAS)
   04217 Necroptosis
    355 (FAS)
   04115 p53 signaling pathway
    355 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    355 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    355 (FAS)
   05205 Proteoglycans in cancer
    355 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    355 (FAS)
   05161 Hepatitis B
    355 (FAS)
   05160 Hepatitis C
    355 (FAS)
   05164 Influenza A
    355 (FAS)
   05162 Measles
    355 (FAS)
   05168 Herpes simplex virus 1 infection
    355 (FAS)
   05163 Human cytomegalovirus infection
    355 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    355 (FAS)
   05169 Epstein-Barr virus infection
    355 (FAS)
   05165 Human papillomavirus infection
    355 (FAS)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    355 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    355 (FAS)
   05143 African trypanosomiasis
    355 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    355 (FAS)
   05330 Allograft rejection
    355 (FAS)
   05332 Graft-versus-host disease
    355 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    355 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    355 (FAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    355 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    355 (FAS)
   04936 Alcoholic liver disease
    355 (FAS)
   04932 Non-alcoholic fatty liver disease
    355 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    355 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    355 (FAS)
   04090 CD molecules [BR:hsa04090]
    355 (FAS)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   355 (FAS)
CD molecules [BR:hsa04090]
 Proteins
  355 (FAS)
SSDB
Motif
Pfam: TNFR_c6 Death Peptidase_C8
Other DBs
NCBI-GeneID: 355
NCBI-ProteinID: NP_000034
OMIM: 134637
HGNC: 11920
Ensembl: ENSG00000026103
Pharos: P25445(Tbio)
UniProt: P25445
Structure
LinkDB
Position
10:88964050..89017059
AA seq 335 aa
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc
aaaagtgttaatgcccaagtgactgacatcaactccaagggattggaattgaggaagact
gttactacagttgagactcagaacttggaaggcctgcatcatgatggccaattctgccat
aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca
gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa
tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc
cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt
gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacactcacc
agcaacaccaagtgcaaagaggaaggatccagatctaacttggggtggctttgtcttctt
cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga
aagcacagaaaggaaaaccaaggttctcatgaatctccaactttaaatcctgaaacagtg
gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg
acactaagtcaagttaaaggctttgttcgaaagaatggtgtcaatgaagccaaaatagat
gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat
tggcatcaacttcatggaaagaaagaagcgtatgacacattgattaaagatctcaaaaaa
gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt
gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag

KEGG   Homo sapiens (human): 7132
Entry
7132              CDS       T01001                                 
Symbol
TNFRSF1A, CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Name
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04936  Alcoholic liver disease
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06131  Apoptosis (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF signaling
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
nt06414  Apoptosis
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00350  HPV E6 to extrinsic apoptotic pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N01114  Salmonella SseK3 to TNF-NFKB signaling pathway
N01275  TNF to TNFR signaling
N01277  TPV 2L to TNFR1/2 signaling
Disease
H00912  Tumor necrosis factor receptor-associated periodic syndrome
H01490  Multiple sclerosis
Drug target
Tasonermin: D08562
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7132 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    7132 (TNFRSF1A)
   04668 TNF signaling pathway
    7132 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    7132 (TNFRSF1A)
   04150 mTOR signaling pathway
    7132 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7132 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    7132 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7132 (TNFRSF1A)
   04215 Apoptosis - multiple species
    7132 (TNFRSF1A)
   04217 Necroptosis
    7132 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7132 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7132 (TNFRSF1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7132 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    7132 (TNFRSF1A)
   05160 Hepatitis C
    7132 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    7132 (TNFRSF1A)
   05164 Influenza A
    7132 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    7132 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    7132 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7132 (TNFRSF1A)
   05165 Human papillomavirus infection
    7132 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7132 (TNFRSF1A)
   05132 Salmonella infection
    7132 (TNFRSF1A)
   05131 Shigellosis
    7132 (TNFRSF1A)
   05152 Tuberculosis
    7132 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    7132 (TNFRSF1A)
   05142 Chagas disease
    7132 (TNFRSF1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7132 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    7132 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    7132 (TNFRSF1A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    7132 (TNFRSF1A)
   05418 Fluid shear stress and atherosclerosis
    7132 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    7132 (TNFRSF1A)
   04932 Non-alcoholic fatty liver disease
    7132 (TNFRSF1A)
   04931 Insulin resistance
    7132 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7132 (TNFRSF1A)
   04090 CD molecules [BR:hsa04090]
    7132 (TNFRSF1A)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   7132 (TNFRSF1A)
CD molecules [BR:hsa04090]
 Proteins
  7132 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 7132
NCBI-ProteinID: NP_001056
OMIM: 191190
HGNC: 11916
Ensembl: ENSG00000067182
Pharos: P19438(Tchem)
UniProt: P19438
Structure
LinkDB
Position
12:complement(6328771..6342076)
AA seq 455 aa
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctaggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattcgatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagaaaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggtcaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcaggtttctttctaagagaaaacgagtgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacgaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcattttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaacccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccgtgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaactttgcggctccccgcagagaggtggcaccaccctatcagggg
gctgaccccatccttgcgacagccctcgcctccgaccccatccccaacccccttcagaag
tgggaggacagcgcccacaagccacagagcctagacactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccagtcttctcagatga

DBGET integrated database retrieval system