KEGG   Homo sapiens (human): 113457
Entry
113457            CDS       T01001                                 

Gene name
TUBA3D, H2-ALPHA, KTCN9, TUBA2
Definition
(RefSeq) tubulin alpha 3d
  KO
K07374  tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04210  Apoptosis
hsa04530  Tight junction
hsa04540  Gap junction
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01285  Microtubule-RHOA signaling pathway
N01286  Escherichia EspG to Microtubule-RHOA signaling pathway
N01295  Rab7-regulated microtubule minus-end directed transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Disease
H00789  Keratoconus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    113457 (TUBA3D)
  09143 Cell growth and death
   04210 Apoptosis
    113457 (TUBA3D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    113457 (TUBA3D)
   04540 Gap junction
    113457 (TUBA3D)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    113457 (TUBA3D)
   05132 Salmonella infection
    113457 (TUBA3D)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113457 (TUBA3D)
   05012 Parkinson disease
    113457 (TUBA3D)
   05014 Amyotrophic lateral sclerosis
    113457 (TUBA3D)
   05016 Huntington disease
    113457 (TUBA3D)
   05020 Prion disease
    113457 (TUBA3D)
   05022 Pathways of neurodegeneration - multiple diseases
    113457 (TUBA3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    113457 (TUBA3D)
   03036 Chromosome and associated proteins [BR:hsa03036]
    113457 (TUBA3D)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    113457 (TUBA3D)
   04147 Exosome [BR:hsa04147]
    113457 (TUBA3D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     113457 (TUBA3D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     113457 (TUBA3D)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    113457 (TUBA3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113457 (TUBA3D)
  Exosomal proteins of other body fluids (saliva and urine)
   113457 (TUBA3D)
  Exosomal proteins of colorectal cancer cells
   113457 (TUBA3D)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 113457
NCBI-ProteinID: NP_525125
OMIM: 617878
HGNC: 24071
Ensembl: ENSG00000075886
Vega: OTTHUMG00000153600
UniProt: P0DPH7 P0DPH8 Q1ZYQ1
LinkDB
Position
2q21.1
AA seq 450 aa
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSVEAEAEEGEEY
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcgcgagtgtatctctatccacgtggggcaggcgggtgtccagatcggcaatgcctgc
tgggaactgtactgccttgaacatggaattcagcccgatggccaaatgccaagtgataaa
accattggtggcggggacgactccttcaacacgttcttcagtgagactggagctggcaag
cacgtgcccagagcagtgtttgtggacctggagcccactgtggtcgatgaagtgcgcaca
gggacctacaggcagctcttccacccggagcagctgatcaccgggaaggaagatgcagcc
aataattacgccaggggccattacaccatcggcaaggagattgttgacctagtcctggac
cggatccgcaaactggcggatctgtgcacaggactgcagggcttcctcatcttccacagc
tttgggggcggcactggctctgggttcgcatctctgctcatggagcggctctcagtggat
tacggcaagaagtccaagctagagtttgccatttacccagccccccaggtctccacagcc
gtggtggagccctacaactccatcctgaccacccacacgaccctggaacattctgactgt
gccttcatggtcgacaatgaagccatctatgacatatgtcggcgcaacctggacattgaa
cgtcccacgtacaccaacctcaatcgcctgattgggcagatcgtgtcctccatcacagcc
tccctgcgatttgatggggccctgaatgtggacttgacggaattccagaccaacctagtg
ccgtacccccgcatccacttccccctggccacctatgccccagtcatctcagctgagaag
gcctaccacgagcagctgtctgtggccgagatcaccaatgcctgcttcgagccagccaat
caaatggtcaagtgtgaccctcgccacggcaagtacatggcctgctgcatgttgtacagg
ggggacgtggtccccaaagacgtcaacgcggccatcgccaccatcaagaccaagcgcacc
atccagtttgtggattggtgcccgactggatttaaggtgggcattaactaccagcccccc
acagtggtccccgggggagacctggccaaggtgcagcgggccgtgtgcatgctgagcaac
accacggccattgcggaggcctgggcccgcctggaccataagttcgatctcatgtatgcc
aagcgggcctttgtgcactggtacgtgggcgaaggcatggaagagggagagttctctgag
gcccgcgaggacctggcagctctagagaaggattatgaagaggtgggcgtggattccgtg
gaagctgaggctgaagaaggcgaagaatactga

DBGET integrated database retrieval system