KEGG   Homo sapiens (human): 7277
Entry
7277              CDS       T01001                                 

Gene name
TUBA4A, ALS22, H2-ALPHA, TUBA1
Definition
(RefSeq) tubulin alpha 4a
  KO
K07374  tubulin alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04210  Apoptosis
hsa04530  Tight junction
hsa04540  Gap junction
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01285  Microtubule-RHOA signaling pathway
N01286  Escherichia EspG to Microtubule-RHOA signaling pathway
N01295  Rab7-regulated microtubule minus-end directed transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7277 (TUBA4A)
  09143 Cell growth and death
   04210 Apoptosis
    7277 (TUBA4A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    7277 (TUBA4A)
   04540 Gap junction
    7277 (TUBA4A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7277 (TUBA4A)
   05132 Salmonella infection
    7277 (TUBA4A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7277 (TUBA4A)
   05012 Parkinson disease
    7277 (TUBA4A)
   05014 Amyotrophic lateral sclerosis
    7277 (TUBA4A)
   05016 Huntington disease
    7277 (TUBA4A)
   05020 Prion disease
    7277 (TUBA4A)
   05022 Pathways of neurodegeneration - multiple diseases
    7277 (TUBA4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7277 (TUBA4A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    7277 (TUBA4A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7277 (TUBA4A)
   04147 Exosome [BR:hsa04147]
    7277 (TUBA4A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     7277 (TUBA4A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     7277 (TUBA4A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    7277 (TUBA4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7277 (TUBA4A)
  Exosomal proteins of other body fluids (saliva and urine)
   7277 (TUBA4A)
  Exosomal proteins of colorectal cancer cells
   7277 (TUBA4A)
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 7277
NCBI-ProteinID: NP_005991
OMIM: 191110
HGNC: 12407
Ensembl: ENSG00000127824
Vega: OTTHUMG00000133126
Pharos: P68366(Tchem)
UniProt: P68366
LinkDB
Position
2q35
AA seq 448 aa
MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK
HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD
RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGIDSYEDEDEGEE
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcgtgaatgcatctcagtccacgtggggcaggcaggtgtccagatgggcaatgcctgc
tgggagctctattgcttggaacatgggattcagcctgatgggcagatgcccagtgacaag
accattggtggaggggacgactccttcaccaccttcttctgtgaaactggtgctggaaaa
cacgtaccccgggcagtttttgtggatctggagcctacggtcattgatgagatccgaaat
ggcccataccgacagctcttccacccagagcagctcatcactgggaaagaggatgctgcc
aacaactatgcccgtggtcactataccattggcaaggagatcattgacccagtgctggat
cggatccgcaagctgtctgaccagtgcacaggacttcagggcttcctggtgttccacagc
tttggtgggggcactggctctggcttcacctcactcctgatggagcggctctctgttgac
tatggcaagaaatccaagctggaattctccatctacccagccccccaggtgtctacagcc
gtggtcgagccctacaactctatcctgaccacccacaccaccctggagcactcagactgt
gccttcatggtggacaacgaagcaatctatgacatctgccgccgcaacctagacatcgag
cgcccaacctacaccaacctcaatcgcctcattagccaaattgtctcctccatcacagct
tctctgcgctttgacggggccctcaatgtggacctgacagagttccagaccaacctggtg
ccctaccctcgcatccacttccccctggccacctatgcaccagtcatctctgcagaaaag
gcataccacgagcagctgtcggtggcagagatcaccaatgcctgctttgagcctgccaac
cagatggtaaagtgtgatccccggcacggcaagtacatggcctgctgcctgctgtaccgt
ggagatgtggtgcccaaggatgtcaacgctgccattgccgccatcaagaccaagcgcagc
attcagtttgtggactggtgccccacaggcttcaaggttggtatcaactaccagcctccc
actgtggtgcctgggggtgacctggccaaggtgcagcgtgccgtgtgcatgctgagcaac
acgaccgccatcgccgaggcctgggcccgcctggaccacaagttcgacctgatgtatgcc
aagagggcgtttgtgcactggtatgtgggtgagggcatggaggagggtgagttctccgag
gcccgtgaggatatggctgccctggagaaggattatgaggaggtgggcatcgactcctat
gaggacgaggatgagggagaagaataa

DBGET integrated database retrieval system