KEGG   Homo sapiens (human): 8737Help
Entry
8737              CDS       T01001                                 

Gene name
RIPK1, IMD57, RIP, RIP-1, RIP1
Definition
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00928  Escherichia NleB to TNF-NFKB signaling pathway
N00945  Shigella IpaH1.4/2.5 to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    8737 (RIPK1)
   04668 TNF signaling pathway
    8737 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8737 (RIPK1)
   04217 Necroptosis
    8737 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    8737 (RIPK1)
   04621 NOD-like receptor signaling pathway
    8737 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    8737 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    8737 (RIPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8737 (RIPK1)
   05132 Salmonella infection
    8737 (RIPK1)
   05131 Shigellosis
    8737 (RIPK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8737 (RIPK1)
   05160 Hepatitis C
    8737 (RIPK1)
   05163 Human cytomegalovirus infection
    8737 (RIPK1)
   05169 Epstein-Barr virus infection
    8737 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8737 (RIPK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8737 (RIPK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   8737 (RIPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Death RHIM Kinase-like RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 8737
NCBI-ProteinID: NP_003795
OMIM: 603453
HGNC: 10019
Ensembl: ENSG00000137275
Vega: OTTHUMG00000014134
Pharos: Q13546(Tchem)
UniProt: Q13546 A0A024QZU0
LinkDB All DBs
Structure
PDB: 

Position
6p25.2
AA seq 671 aa AA seqDB search
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagacatgtccttgaatgtcattaagatgaaatccagtgacttcctggagagt
gcagaactggacagcggaggctttgggaaggtgtctctgtgtttccacagaacccaggga
ctcatgatcatgaaaacagtgtacaaggggcccaactgcattgagcacaacgaggccctc
ttggaggaggcgaagatgatgaacagactgagacacagccgggtggtgaagctcctgggc
gtcatcatagaggaagggaagtactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctgaaagccgagatgagtactccgctttctgtaaaaggaaggataattttg
gaaatcattgaaggaatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgataatgacttccacattaagatcgcagacctcggccttgcc
tcctttaagatgtggagcaaactgaataatgaagagcacaatgagctgagggaagtggac
ggcaccgctaagaagaatggcggcaccctctactacatggcgcccgagcacctgaatgac
gtcaacgcaaagcccacagagaagtcggatgtgtacagctttgctgtagtactctgggcg
atatttgcaaataaggagccatatgaaaatgctatctgtgagcagcagttgataatgtgc
ataaaatctgggaacaggccagatgtggatgacatcactgagtactgcccaagagaaatt
atcagtctcatgaagctctgctgggaagcgaatccggaagctcggccgacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattagaagaaagtgtagaagaggac
gtgaagagtttaaagaaagagtattcaaacgaaaatgcagttgtgaagagaatgcagtct
cttcaacttgattgtgtggcagtaccttcaagccggtcaaattcagccacagaacagcct
ggttcactgcacagttcccagggacttgggatgggtcctgtggaggagtcctggtttgct
ccttccctggagcacccacaagaagagaatgagcccagcctgcagagtaaactccaagac
gaagccaactaccatctttatggcagccgcatggacaggcagacgaaacagcagcccaga
cagaatgtggcttacaacagagaggaggaaaggagacgcagggtctcccatgaccctttt
gcacagcaaagaccttacgagaattttcagaatacagagggaaaaggcactgcttattcc
agtgcagccagtcatggtaatgcagtgcaccagccctcagggctcaccagccaacctcaa
gtactgtatcagaacaatggattatatagctcacatggctttggaacaagaccactggat
ccaggaacagcaggtcccagagtttggtacaggccaattccaagtcatatgcctagtctg
cataatatcccagtgcctgagaccaactatctaggaaatacacccaccatgccattcagc
tccttgccaccaacagatgaatctataaaatataccatatacaatagtactggcattcag
attggagcctacaattatatggagattggtgggacgagttcatcactactagacagcaca
aatacgaacttcaaagaagagccagctgctaagtaccaagctatctttgataataccact
agtctgacggataaacacctggacccaatcagggaaaatctgggaaagcactggaaaaac
tgtgcccgtaaactgggcttcacacagtctcagattgatgaaattgaccatgactatgag
cgagatggactgaaagaaaaggtttaccagatgctccaaaagtgggtgatgagggaaggc
ataaagggagccacggtggggaagctggcccaggcgctccaccagtgttccaggatcgac
cttctgagcagcttgatttacgtcagccagaactaa

KEGG   Homo sapiens (human): 8717Help
Entry
8717              CDS       T01001                                 

Gene name
TRADD, Hs.89862
Definition
(RefSeq) TNFRSF1A associated via death domain
  KO
K03171  tumor necrosis factor receptor type 1-associated DEATH domain protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06131  Apoptosis (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF-NFKB signaling
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
  Element
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00350  HPV E6 to extrinsic apoptotic pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00524  HCV NS5A to extrinsic apoptotic pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8717 (TRADD)
   04064 NF-kappa B signaling pathway
    8717 (TRADD)
   04668 TNF signaling pathway
    8717 (TRADD)
   04071 Sphingolipid signaling pathway
    8717 (TRADD)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    8717 (TRADD)
   04217 Necroptosis
    8717 (TRADD)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    8717 (TRADD)
   04657 IL-17 signaling pathway
    8717 (TRADD)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    8717 (TRADD)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8717 (TRADD)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8717 (TRADD)
   05132 Salmonella infection
    8717 (TRADD)
   05131 Shigellosis
    8717 (TRADD)
   05152 Tuberculosis
    8717 (TRADD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8717 (TRADD)
   05162 Measles
    8717 (TRADD)
   05164 Influenza A
    8717 (TRADD)
   05160 Hepatitis C
    8717 (TRADD)
   05168 Herpes simplex virus 1 infection
    8717 (TRADD)
   05163 Human cytomegalovirus infection
    8717 (TRADD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    8717 (TRADD)
   05169 Epstein-Barr virus infection
    8717 (TRADD)
   05165 Human papillomavirus infection
    8717 (TRADD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRADD_N Death
Motif
Other DBs
NCBI-GeneID: 8717
NCBI-ProteinID: NP_001310481
OMIM: 603500
HGNC: 12030
Ensembl: ENSG00000102871
Vega: OTTHUMG00000137519
Pharos: Q15628(Tbio)
UniProt: Q15628
LinkDB All DBs
Structure
PDB: 

Position
16q22.1
AA seq 312 aa AA seqDB search
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPL
QPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRG
CRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAED
LLGLTDPNGGLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgggcaaaatgggcacgaagagtgggtgggcagcgcatacctgtttgtggag
tcctcgctggacaaggtggtcctgtcggatgcctacgcgcacccccagcagaaggtggca
gtgtacagggctctgcaggctgccttggcagagagcggcgggagcccggacgtgctgcag
atgctgaagatccaccgcagcgacccgcagctgatcgtgcagctgcgattctgcgggcgg
cagccctgtggccgcttcctccgcgcctaccgcgagggggcgctgcgcgccgcgctgcag
aggagcctggcggccgcgctcgcccagcactcggtgccgctgcaactggagctgcgcgcc
ggcgccgagcggctggacgctttgctggcggacgaggagcgctgtttgagttgcatccta
gcccagcagcccgaccggctccgggatgaagaactggctgagctggaggatgcgctgcga
aatctgaagtgcggctcgggggcccggggtggcgacggggaggtcgcttcggcccccttg
cagcccccggtgccctctctgtcggaggtgaagccgccgccgccgccgccacctgcccag
acttttctgttccagggtcagcctgtagtgaatcggccgctgagcctgaaggaccaacag
acgttcgcgcgctctgtgggtctcaaatggcgcaaggtggggcgctcactgcagcgaggc
tgccgggcgctgcgggacccggcgctggactcgctggcctacgagtacgagcgcgaggga
ctgtacgagcaggccttccagctgctgcggcgcttcgtgcaggccgagggccgccgcgcc
acgctgcagcgcctggtggaggcactcgaggagaacgagctcaccagcctggcagaggac
ttgctgggcctgaccgatcccaatggcggcctggcctag

KEGG   Homo sapiens (human): 7186Help
Entry
7186              CDS       T01001                                 

Gene name
TRAF2, MGC:45012, RNF117, TRAP, TRAP3
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00505  CD40-NFKB signaling pathway
N00525  HCV NS5A to TNF-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00928  Escherichia NleB to TNF-NFKB signaling pathway
N00944  Shigella OspI to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7186 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7186 (TRAF2)
   04064 NF-kappa B signaling pathway
    7186 (TRAF2)
   04668 TNF signaling pathway
    7186 (TRAF2)
   04071 Sphingolipid signaling pathway
    7186 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7186 (TRAF2)
   04217 Necroptosis
    7186 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7186 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    7186 (TRAF2)
   04657 IL-17 signaling pathway
    7186 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7186 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    7186 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7186 (TRAF2)
   05203 Viral carcinogenesis
    7186 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7186 (TRAF2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    7186 (TRAF2)
   05017 Spinocerebellar ataxia
    7186 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7186 (TRAF2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7186 (TRAF2)
   05132 Salmonella infection
    7186 (TRAF2)
   05131 Shigellosis
    7186 (TRAF2)
   05135 Yersinia infection
    7186 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7186 (TRAF2)
   05160 Hepatitis C
    7186 (TRAF2)
   05168 Herpes simplex virus 1 infection
    7186 (TRAF2)
   05163 Human cytomegalovirus infection
    7186 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7186 (TRAF2)
   05169 Epstein-Barr virus infection
    7186 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7186 (TRAF2)
   04121 Ubiquitin system [BR:hsa04121]
    7186 (TRAF2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7186 (TRAF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     7186 (TRAF2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7186 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH SlyX DUF1664
Motif
Other DBs
NCBI-GeneID: 7186
NCBI-ProteinID: NP_066961
OMIM: 601895
HGNC: 12032
Ensembl: ENSG00000127191
Vega: OTTHUMG00000020952
Pharos: Q12933(Tbio)
UniProt: Q12933 A0A024R8H5
LinkDB All DBs
Structure
PDB: 

Position
9q34.3
AA seq 501 aa AA seqDB search
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccctggagttgctacagcccggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcagaaacgtc
ctccgcaggcccttccaggcgcagtgtggccaccggtactgctccttctgcctggccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggccttcccagataatgctgcccgcagggaggtg
gagagcctgccggccgtctgtcccagtgatggatgcacctggaaggggaccctgaaagaa
tacgagagctgccacgaaggccgctgcccgctcatgctgaccgaatgtcccgcgtgcaaa
ggcctggtccgccttggtgaaaaggagcgccacctggagcacgagtgcccggagagaagc
ctgagctgccggcattgccgggcaccctgctgcggagcagacgtgaaggcgcaccacgag
gtctgccccaagttccccttaacttgtgacggctgcggcaagaagaagatcccccgggag
aagtttcaggaccacgtcaagacttgtggcaagtgtcgagtcccttgcagattccacgcc
atcggctgcctcgagacggtagagggtgagaaacagcaggagcacgaggtgcagtggctg
cgggagcacctggccatgctactgagctcggtgctggaggcaaagcccctcttgggagac
cagagccacgcggggtcagagctcctgcagaggtgcgagagcctggagaagaagacggcc
acttttgagaacattgtctgcgtcctgaaccgggaggtggagagggtggccatgactgcc
gaggcctgcagccggcagcaccggctggaccaagacaagattgaagccctgagtagcaag
gtgcagcagctggagaggagcattggcctcaaggacctggcgatggctgacttggagcag
aaggtcttggagatggaggcatccacctacgatggggtcttcatctggaagatctcagac
ttcgccaggaagcgccaggaagctgtggctggccgcatacccgccatcttctccccagcc
ttctacaccagcaggtacggctacaagatgtgtctgcgtatctacctgaacggcgacggc
accgggcgaggaacacacctgtccctcttctttgtggtgatgaagggcccgaatgacgcc
ctgctgcggtggcccttcaaccagaaggtgaccttaatgctgctcgaccagaataaccgg
gagcacgtgattgacgccttcaggcccgacgtgacttcatcctcttttcagaggccagtc
aacgacatgaacatcgcaagcggctgccccctcttctgccccgtctccaagatggaggca
aagaattcctacgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

KEGG   Homo sapiens (human): 7188Help
Entry
7188              CDS       T01001                                 

Gene name
TRAF5, MGC:39780, RNF84
Definition
(RefSeq) TNF receptor associated factor 5
  KO
K09849  TNF receptor-associated factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05131  Shigellosis
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06114  PI3K signaling (viruses)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06223  TNF-NFKB signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7188 (TRAF5)
   04668 TNF signaling pathway
    7188 (TRAF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7188 (TRAF5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7188 (TRAF5)
   04657 IL-17 signaling pathway
    7188 (TRAF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7188 (TRAF5)
   05203 Viral carcinogenesis
    7188 (TRAF5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7188 (TRAF5)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7188 (TRAF5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7188 (TRAF5)
   05168 Herpes simplex virus 1 infection
    7188 (TRAF5)
   05163 Human cytomegalovirus infection
    7188 (TRAF5)
   05169 Epstein-Barr virus infection
    7188 (TRAF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7188 (TRAF5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7188 (TRAF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4 zf-C3HC4_4 zf-TRAF_2 Sina Spc29 zf-RING_6 zf-ACC ATG16 zf-RING_2 zf-RING_UBOX Acetyltransf_11 Mt_ATP_synt PHM7_cyt FlaC_arch DUF1664 DUF4279 Tropomyosin_1 Spc7
Motif
Other DBs
NCBI-GeneID: 7188
NCBI-ProteinID: NP_001029082
OMIM: 602356
HGNC: 12035
Ensembl: ENSG00000082512
Vega: OTTHUMG00000036997
Pharos: O00463(Tbio)
UniProt: O00463
LinkDB All DBs
Position
1q32.3
AA seq 557 aa AA seqDB search
MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC
GHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKV
ILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINL
QNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQ
HEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFG
KNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLE
NNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQ
RVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKD
DTLFLKVAVDLTDLEDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcttattcagaagagcataaaggtatgccctgtggtttcatccgccagaattccggc
aactccatttccttggactttgagcccagtatagagtaccagtttgtggagcggttggaa
gagcgctacaaatgtgccttctgccactcggtgcttcacaacccccaccagacaggatgt
gggcaccgcttctgccagcactgcatcctgtccctgagagaattaaacacagtgccaatc
tgccctgtagataaagaggtcatcaaatctcaggaggtttttaaagacaattgttgcaaa
agagaagtcctcaacttatatgtatattgcagcaatgctcctggatgtaatgccaaggtt
attctgggccggtaccaggatcaccttcagcagtgcttatttcaacctgtgcagtgttct
aatgagaagtgccgggagccagtcctacggaaagacctgaaagagcatttgagtgcatcc
tgtcagtttcgaaaggaaaaatgcctttattgcaaaaaggatgtggtagtcatcaatcta
cagaatcatgaggaaaacttgtgtcctgaatacccagtattttgtcccaacaattgtgcg
aagattattctaaaaactgaggtagatgaacacctggctgtatgtcctgaagctgagcaa
gactgtccttttaagcactatggctgtgctgtaacggataaacggaggaacctgcagcaa
catgagcattcagccttacgggagcacatgcgtttggttttagaaaagaatgtccaatta
gaagaacagatttctgacttacacaagagcctagaacagaaagaaagtaaaatccagcag
ctagcagaaactataaagaaacttgaaaaggagttcaagcagtttgcacagttgtttggc
aaaaatggaagcttcctcccaaacatccaggtttttgccagtcacattgacaagtcagct
tggctagaagctcaagtgcatcaattattacaaatggttaaccagcaacaaaataaattt
gacctgagacctttgatggaagcagttgatacagtgaaacagaaaattaccctgctagaa
aacaatgatcaaagattagccgttttagaagaggaaactaacaaacatgatacccacatt
aatattcataaagcacagctgagtaaaaatgaagagcgatttaaactgctggagggtact
tgctataatggaaagctcatttggaaggtgacagattacaagatgaagaagagagaggcg
gtggatgggcacacagtgtccatcttcagccagtccttctacaccagccgctgtggctac
cggctctgtgctagagcatacctgaatggggatgggtcagggagggggtcacacctgtcc
ctatactttgtggtcatgcgaggagagtttgactcactgttgcagtggccattcaggcag
agggtgaccctgatgcttctggaccagagtggcaaaaagaacattatggagaccttcaaa
cctgaccccaatagcagcagctttaaaagacctgatggggagatgaacattgcatctggc
tgtccccgctttgtggctcattctgttttggagaatgccaagaacgcctacattaaagat
gacactctgttcttgaaagtggccgtggacttaactgacctggaggatctctag

DBGET integrated database retrieval system