KEGG   Homo sapiens (human): 7412
Entry
7412              CDS       T01001                                 

Gene name
VCAM1, CD106, INCAM-100
Definition
(RefSeq) vascular cell adhesion molecule 1
  KO
K06527  vascular cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01306  AngII-AT1R-NOX2 signaling pathway
Drug target
Camobucol: D06570
Elsibucol: D06582
Succinobucol: D06648
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7412 (VCAM1)
   04668 TNF signaling pathway
    7412 (VCAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    7412 (VCAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7412 (VCAM1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    7412 (VCAM1)
   05143 African trypanosomiasis
    7412 (VCAM1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    7412 (VCAM1)
   05418 Fluid shear stress and atherosclerosis
    7412 (VCAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7412 (VCAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    7412 (VCAM1)
   04091 Lectins [BR:hsa04091]
    7412 (VCAM1)
CD molecules [BR:hsa04090]
 Proteins
  7412 (VCAM1)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  7412 (VCAM1)
SSDB
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set C2-set_2 ICAM_N Ig_4 Ig_5 Ig_6 Adhes-Ig_like
Other DBs
NCBI-GeneID: 7412
NCBI-ProteinID: NP_001069
OMIM: 192225
HGNC: 12663
Ensembl: ENSG00000162692
Vega: OTTHUMG00000010982
Pharos: P19320(Tchem)
UniProt: P19320
LinkDB
Structure
PDB: 
1VCA 1VSC 1IJ9

Position
1p21.2
AA seq 739 aa
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgcctgggaagatggtcgtgatccttggagcctcaaatatactttggataatgtttgca
gcttctcaagcttttaaaatcgagaccaccccagaatctagatatcttgctcagattggt
gactccgtctcattgacttgcagcaccacaggctgtgagtccccatttttctcttggaga
acccagatagatagtccactgaatgggaaggtgacgaatgaggggaccacatctacgctg
acaatgaatcctgttagttttgggaacgaacactcttacctgtgcacagcaacttgtgaa
tctaggaaattggaaaaaggaatccaggtggagatctactcttttcctaaggatccagag
attcatttgagtggccctctggaggctgggaagccgatcacagtcaagtgttcagttgct
gatgtatacccatttgacaggctggagatagacttactgaaaggagatcatctcatgaag
agtcaggaatttctggaggatgcagacaggaagtccctggaaaccaagagtttggaagta
acctttactcctgtcattgaggatattggaaaagttcttgtttgccgagctaaattacac
attgatgaaatggattctgtgcccacagtaaggcaggctgtaaaagaattgcaagtctac
atatcacccaagaatacagttatttctgtgaatccatccacaaagctgcaagaaggtggc
tctgtgaccatgacctgttccagcgagggtctaccagctccagagattttctggagtaag
aaattagataatgggaatctacagcacctttctggaaatgcaactctcaccttaattgct
atgaggatggaagattctggaatttatgtgtgtgaaggagttaatttgattgggaaaaac
agaaaagaggtggaattaattgttcaagagaaaccatttactgttgagatctcccctgga
ccccggattgctgctcagattggagactcagtcatgttgacatgtagtgtcatgggctgt
gaatccccatctttctcctggagaacccagatagacagccctctgagcgggaaggtgagg
agtgaggggaccaattccacgctgaccctgagccctgtgagttttgagaacgaacactct
tatctgtgcacagtgacttgtggacataagaaactggaaaagggaatccaggtggagctc
tactcattccctagagatccagaaatcgagatgagtggtggcctcgtgaatgggagctct
gtcactgtaagctgcaaggttcctagcgtgtacccccttgaccggctggagattgaatta
cttaagggggagactattctggagaatatagagtttttggaggatacggatatgaaatct
ctagagaacaaaagtttggaaatgaccttcatccctaccattgaagatactggaaaagct
cttgtttgtcaggctaagttacatattgatgacatggaattcgaacccaaacaaaggcag
agtacgcaaacactttatgtcaatgttgcccccagagatacaaccgtcttggtcagccct
tcctccatcctggaggaaggcagttctgtgaatatgacatgcttgagccagggctttcct
gctccgaaaatcctgtggagcaggcagctccctaacggggagctacagcctctttctgag
aatgcaactctcaccttaatttctacaaaaatggaagattctggggtttatttatgtgaa
ggaattaaccaggctggaagaagcagaaaggaagtggaattaattatccaagttactcca
aaagacataaaacttacagcttttccttctgagagtgtcaaagaaggagacactgtcatc
atctcttgtacatgtggaaatgttccagaaacatggataatcctgaagaaaaaagcggag
acaggagacacagtactaaaatctatagatggcgcctataccatccgaaaggcccagttg
aaggatgcgggagtatatgaatgtgaatctaaaaacaaagttggctcacaattaagaagt
ttaacacttgatgttcaaggaagagaaaacaacaaagactatttttctcctgagcttctc
gtgctctattttgcatcctccttaataatacctgccattggaatgataatttactttgca
agaaaagccaacatgaaggggtcatatagtcttgtagaagcacagaagtcaaaagtgtag

KEGG   Homo sapiens (human): 3569
Entry
3569              CDS       T01001                                 

Gene name
IL6, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01523  Antifolate resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05321  Inflammatory bowel disease
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy
hsa05417  Lipid and atherosclerosis
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06227  Nuclear receptor signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06360  Cushing syndrome
nt06417  AGE-RAGE signaling
nt06460  Alzheimer disease
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00317  AhR signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01266  IL6 to IL6R signaling
N01306  AngII-AT1R-NOX2 signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
Disease
H00084  Graft-versus-host disease
H01479  Castleman disease
H01672  Juvenile idiopathic arthritis
Drug target
Pirfenidone: D01583<JP/US>
Pomalidomide: D08976<JP/US>
Siltuximab: D09669<US>
Sirukumab: D10080
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3569 (IL6)
   04668 TNF signaling pathway
    3569 (IL6)
   04066 HIF-1 signaling pathway
    3569 (IL6)
   04068 FoxO signaling pathway
    3569 (IL6)
   04151 PI3K-Akt signaling pathway
    3569 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3569 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3569 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3569 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3569 (IL6)
   04620 Toll-like receptor signaling pathway
    3569 (IL6)
   04621 NOD-like receptor signaling pathway
    3569 (IL6)
   04623 Cytosolic DNA-sensing pathway
    3569 (IL6)
   04625 C-type lectin receptor signaling pathway
    3569 (IL6)
   04659 Th17 cell differentiation
    3569 (IL6)
   04657 IL-17 signaling pathway
    3569 (IL6)
   04672 Intestinal immune network for IgA production
    3569 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3569 (IL6)
   05202 Transcriptional misregulation in cancer
    3569 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3569 (IL6)
   05161 Hepatitis B
    3569 (IL6)
   05171 Coronavirus disease - COVID-19
    3569 (IL6)
   05164 Influenza A
    3569 (IL6)
   05162 Measles
    3569 (IL6)
   05168 Herpes simplex virus 1 infection
    3569 (IL6)
   05163 Human cytomegalovirus infection
    3569 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3569 (IL6)
   05169 Epstein-Barr virus infection
    3569 (IL6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3569 (IL6)
   05132 Salmonella infection
    3569 (IL6)
   05135 Yersinia infection
    3569 (IL6)
   05133 Pertussis
    3569 (IL6)
   05134 Legionellosis
    3569 (IL6)
   05152 Tuberculosis
    3569 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3569 (IL6)
   05144 Malaria
    3569 (IL6)
   05142 Chagas disease
    3569 (IL6)
   05143 African trypanosomiasis
    3569 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3569 (IL6)
   05321 Inflammatory bowel disease
    3569 (IL6)
   05332 Graft-versus-host disease
    3569 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3569 (IL6)
   05020 Prion disease
    3569 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    3569 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3569 (IL6)
   05410 Hypertrophic cardiomyopathy
    3569 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    3569 (IL6)
   04931 Insulin resistance
    3569 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3569 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3569 (IL6)
   01523 Antifolate resistance
    3569 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3569 (IL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3569 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF
Other DBs
NCBI-GeneID: 3569
NCBI-ProteinID: NP_000591
OMIM: 147620
HGNC: 6018
Ensembl: ENSG00000136244
Vega: OTTHUMG00000023178
Pharos: P05231(Tclin)
UniProt: P05231 Q75MH2 B4DVM1
LinkDB
Structure
PDB: 

Position
7p15.3
AA seq 212 aa
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

KEGG   Homo sapiens (human): 4313
Entry
4313              CDS       T01001                                 

Gene name
MMP2, CLG4, CLG4A, MMP-2, MMP-II, MONA, TBE-1
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04670  Leukocyte transendothelial migration
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05219  Bladder cancer
hsa05415  Diabetic cardiomyopathy
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01306  AngII-AT1R-NOX2 signaling pathway
Disease
H00025  Penile cancer
H00028  Choriocarcinoma
H00472  Torg syndrome
Drug target
Batimastat: D03061
Ilomastat: D03793
Marimastat: D03795
Prinomastat: D03797
Rebimastat: D03800
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4313 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    4313 (MMP2)
   04915 Estrogen signaling pathway
    4313 (MMP2)
   04926 Relaxin signaling pathway
    4313 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4313 (MMP2)
   05205 Proteoglycans in cancer
    4313 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    4313 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4313 (MMP2)
   05415 Diabetic cardiomyopathy
    4313 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    4313 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4313 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4313 (MMP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     4313 (MMP2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4313 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 4313
NCBI-ProteinID: NP_004521
OMIM: 120360
HGNC: 7166
Ensembl: ENSG00000087245
Vega: OTTHUMG00000133202
Pharos: P08253(Tchem)
UniProt: P08253 A0A024R6R4
LinkDB
Structure
PDB: 

Position
16q12.2
AA seq 660 aa
MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQ
IRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEY
WIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP
GFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggaggcgctaatggcccggggcgcgctcacgggtcccctgagggcgctctgtctcctg
ggctgcctgctgagccacgccgccgccgcgccgtcgcccatcatcaagttccccggcgat
gtcgcccccaaaacggacaaagagttggcagtgcaatacctgaacaccttctatggctgc
cccaaggagagctgcaacctgtttgtgctgaaggacacactaaagaagatgcagaagttc
tttggactgccccagacaggtgatcttgaccagaataccatcgagaccatgcggaagcca
cgctgcggcaacccagatgtggccaactacaacttcttccctcgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggctacacacctgatctggacccagagacagtg
gatgatgcctttgctcgtgccttccaagtctggagcgatgtgaccccactgcggttttct
cgaatccatgatggagaggcagacatcatgatcaactttggccgctgggagcatggcgat
ggatacccctttgacggtaaggacggactcctggctcatgccttcgccccaggcactggt
gttgggggagactcccattttgatgacgatgagctatggaccttgggagaaggccaagtg
gtccgtgtgaagtatgggaacgccgatggggagtactgcaagttccccttcttgttcaat
ggcaaggagtacaacagctgcactgataccggccgcagcgatggcttcctctggtgctcc
accacctacaactttgagaaggatggcaagtacggcttctgtccccatgaagccctgttc
accatgggcggcaacgctgaaggacagccctgcaagtttccattccgcttccagggcaca
tcctatgacagctgcaccactgagggccgcacggatggctaccgctggtgcggcaccact
gaggactacgaccgcgacaagaagtatggcttctgccctgagaccgccatgtccactgtt
ggtgggaactcagaaggtgccccctgtgtcttccccttcactttcctgggcaacaaatat
gagagctgcaccagcgccggccgcagtgacggaaagatgtggtgtgcgaccacagccaac
tacgatgatgaccgcaagtggggcttctgccctgaccaagggtacagcctgttcctcgtg
gcagcccacgagtttggccacgccatggggctggagcactcccaagaccctggggccctg
atggcacccatttacacctacaccaagaacttccgtctgtcccaggatgacatcaagggc
attcaggagctctatggggcctctcctgacattgaccttggcaccggccccacccccacg
ctgggccctgtcactcctgagatctgcaaacaggacattgtatttgatggcatcgctcag
atccgtggtgagatcttcttcttcaaggaccggttcatttggcggactgtgacgccacgt
gacaagcccatggggcccctgctggtggccacattctggcctgagctcccggaaaagatt
gatgcggtatacgaggccccacaggaggagaaggctgtgttctttgcagggaatgaatac
tggatctactcagccagcaccctggagcgagggtaccccaagccactgaccagcctggga
ctgccccctgatgtccagcgagtggatgccgcctttaactggagcaaaaacaagaagaca
tacatctttgctggagacaaattctggagatacaatgaggtgaagaagaaaatggatcct
ggcttccccaagctcatcgcagatgcctggaatgccatccccgataacctggatgccgtc
gtggacctgcagggcggcggtcacagctacttcttcaagggtgcctattacctgaagctg
gagaaccaaagtctgaagagcgtgaagtttggaagcatcaaatccgactggctaggctgc
tga

KEGG   Homo sapiens (human): 4318
Entry
4318              CDS       T01001                                 

Gene name
MMP9, CLG4B, GELB, MANDP2, MMP-9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04915  Estrogen signaling pathway
hsa04926  Relaxin signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05219  Bladder cancer
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00130  TMPRSS2-ETV5 fusion to transcriptional activation
N00545  HBV HBx to ERK signaling pathway
N01306  AngII-AT1R-NOX2 signaling pathway
Disease
H00025  Penile cancer
H00479  Metaphyseal dysplasias
Drug target
Andecaliximab: D11262
Batimastat: D03061
Cipemastat: D03517
Ilomastat: D03793
Marimastat: D03795
Prinomastat: D03797
Rebimastat: D03800
Tanomastat: D03802
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4318 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    4318 (MMP9)
   04670 Leukocyte transendothelial migration
    4318 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    4318 (MMP9)
   04926 Relaxin signaling pathway
    4318 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4318 (MMP9)
   05202 Transcriptional misregulation in cancer
    4318 (MMP9)
   05206 MicroRNAs in cancer
    4318 (MMP9)
   05205 Proteoglycans in cancer
    4318 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    4318 (MMP9)
   05215 Prostate cancer
    4318 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    4318 (MMP9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    4318 (MMP9)
   05418 Fluid shear stress and atherosclerosis
    4318 (MMP9)
   05415 Diabetic cardiomyopathy
    4318 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4318 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4318 (MMP9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     4318 (MMP9)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M10
   4318 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953 Peptidase_M66
Other DBs
NCBI-GeneID: 4318
NCBI-ProteinID: NP_004985
OMIM: 120361
HGNC: 7176
Ensembl: ENSG00000100985
Vega: OTTHUMG00000033044
Pharos: P14780(Tchem)
UniProt: P14780
LinkDB
Structure
PDB: 

Position
20q13.12
AA seq 707 aa
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc
tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc
aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc
cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

DBGET integrated database retrieval system