KEGG   Homo sapiens (human): 10381
Entry
10381             CDS       T01001                                 

Gene name
TUBB3, CDCBM, CDCBM1, CFEOM3, CFEOM3A, FEOM3, TUBB4, beta-4
Definition
(RefSeq) tubulin beta 3 class III
  KO
K07375  tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04540  Gap junction
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N00978  Anterograde axonal transport
N00979  Mutation-caused aberrant Htt to anterograde axonal transport
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
N01158  Mutation-caused aberrant DCTN1 to retrograde axonal transport
N01285  Microtubule-RHOA signaling pathway
N01286  Escherichia EspG to Microtubule-RHOA signaling pathway
N01295  Rab7-regulated microtubule minus-end directed transport
N01297  Arl8-regulated microtubule plus-end directed transport
N01298  Salmonella SifA to microtubule plus-end directed transport
N01299  Salmonella PipB2 to microtubule plus-end directed transport
Disease
H00838  Congenital fibrosis of the extraocular muscles
H01881  Complex cortical dysplasia with other brain malformations
Drug target
Avanbulin: D11681
Batabulin (DG01412): D03059 D06560
Belantamab mafodotin: D11595<US>
Brentuximab vedotin: D09587<JP/US>
Cabazitaxel (DG00695): D09755 D10452<JP/US>
Cevipabulin (DG01413): D06576 D08889
Colchicine: D00570<JP/US>
Denintuzumab mafodotin: D11232
Docetaxel (DG00694): D02165<JP/US> D07866<JP/US>
Enfortumab vedotin: D11525<US>
Eribulin: D08914<JP/US>
Estramustine (DG00724): D02398 D04066 D06397<JP/US>
Glembatumumab vedotin: D09912
Indibulin: D10013
Ixabepilone: D04645
Lexibulin: D10073
Lifastuzumab vedotin: D11238
Lisavanbulin: D11494
Maytansine: D04864
Mivobulin isethionate: D05062
Paclitaxel: D00491<JP/US>
Paclitaxel poliglumex: D05333
Soblidotin: D01919
Taltobulin: D06001
Tasidotin hydrochloride: D06009
Tirbanibulin (DG03082): D11691<US> D11692
Trastuzumab emtansine: D09980<JP/US>
Verubulin (DG01411): D10029 D10030
Vinblastine (DG00689): D01068<JP/US> D08675
Vincristine (DG00690): D02197<JP/US> D08679
Vindesine (DG00691): D01769<JP> D06304
Vinepidine sulfate: D06305
Vinflunine: D09032
Vinglycinate sulfate: D06306
Vinleurosine sulfate: D06307
Vinorelbine (DG00692): D01935<JP/US> D08680
Vinrosidine sulfate: D06308
Vinzolidine sulfate: D06309
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    10381 (TUBB3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    10381 (TUBB3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10381 (TUBB3)
   05132 Salmonella infection
    10381 (TUBB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10381 (TUBB3)
   05012 Parkinson disease
    10381 (TUBB3)
   05014 Amyotrophic lateral sclerosis
    10381 (TUBB3)
   05016 Huntington disease
    10381 (TUBB3)
   05020 Prion disease
    10381 (TUBB3)
   05022 Pathways of neurodegeneration - multiple diseases
    10381 (TUBB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10381 (TUBB3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10381 (TUBB3)
   04147 Exosome [BR:hsa04147]
    10381 (TUBB3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     10381 (TUBB3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    10381 (TUBB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10381 (TUBB3)
  Exosomal proteins of colorectal cancer cells
   10381 (TUBB3)
  Exosomal proteins of bladder cancer cells
   10381 (TUBB3)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Other DBs
NCBI-GeneID: 10381
NCBI-ProteinID: NP_006077
OMIM: 602661
HGNC: 20772
Ensembl: ENSG00000258947
Vega: OTTHUMG00000138985
Pharos: Q13509(Tclin)
UniProt: Q13509 Q53G92
LinkDB
Structure
PDB: 
6E7B 5IJ9 5IJ0 5JCO

Position
16q24.3
AA seq 450 aa
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYV
PRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEMYEDDEEESEAQGPK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagggagatcgtgcacatccaggccggccagtgcggcaaccagatcggggccaagttc
tgggaagtcatcagtgatgagcatggcatcgaccccagcggcaactacgtgggcgactcg
gacttgcagctggagcggatcagcgtctactacaacgaggcctcttctcacaagtacgtg
cctcgagccattctggtggacctggaacccggaaccatggacagtgtccgctcaggggcc
tttggacatctcttcaggcctgacaatttcatctttggtcagagtggggccggcaacaac
tgggccaagggtcactacacggagggggcggagctggtggattcggtcctggatgtggtg
cggaaggagtgtgaaaactgcgactgcctgcagggcttccagctgacccactcgctgggg
ggcggcacgggctccggcatgggcacgttgctcatcagcaaggtgcgtgaggagtatccc
gaccgcatcatgaacaccttcagcgtcgtgccctcacccaaggtgtcagacacggtggtg
gagccctacaacgccacgctgtccatccaccagctggtggagaacacggatgagacctac
tgcatcgacaacgaggcgctctacgacatctgcttccgcaccctcaagctggccacgccc
acctacggggacctcaaccacctggtatcggccaccatgagcggagtcaccacctccttg
cgcttcccgggccagctcaacgctgacctgcgcaagctggccgtcaacatggtgcccttc
ccgcgcctgcacttcttcatgcccggcttcgcccccctcacagcccggggcagccagcag
taccgggccctgaccgtgcccgagctcacccagcagatgttcgatgccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgacggtggccaccgtgttccggggccgc
atgtccatgaaggaggtggacgagcagatgctggccatccagagcaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaaggtggccgtgtgtgacatcccgccccgcggc
ctcaagatgtcctccaccttcatcgggaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgaggaagagggcgagatgtacgaagacgac
gaggaggagtcggaggcccagggccccaagtga

DBGET integrated database retrieval system