KEGG   Homo sapiens (human): 1950
Entry
1950              CDS       T01001                                 

Symbol
EGF, HOMG4, URG
Name
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  JAK-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05226  Gastric cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06114  PI3K signaling (viruses)
nt06120  Calcium signaling (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling
nt06213  Other RAS signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06220  Calcium signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00033  EGF-EGFR-PI3K signaling pathway
N00034  ERBB2-overexpression to PI3K signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00281  EGF-overexpression to PI3K signaling pathway
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00020  Colorectal cancer
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1950 (EGF)
   04012 ErbB signaling pathway
    1950 (EGF)
   04014 Ras signaling pathway
    1950 (EGF)
   04015 Rap1 signaling pathway
    1950 (EGF)
   04630 JAK-STAT signaling pathway
    1950 (EGF)
   04066 HIF-1 signaling pathway
    1950 (EGF)
   04068 FoxO signaling pathway
    1950 (EGF)
   04020 Calcium signaling pathway
    1950 (EGF)
   04072 Phospholipase D signaling pathway
    1950 (EGF)
   04151 PI3K-Akt signaling pathway
    1950 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1950 (EGF)
   04540 Gap junction
    1950 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1950 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1950 (EGF)
   05207 Chemical carcinogenesis - receptor activation
    1950 (EGF)
   05208 Chemical carcinogenesis - reactive oxygen species
    1950 (EGF)
   05231 Choline metabolism in cancer
    1950 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    1950 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1950 (EGF)
   05212 Pancreatic cancer
    1950 (EGF)
   05226 Gastric cancer
    1950 (EGF)
   05214 Glioma
    1950 (EGF)
   05218 Melanoma
    1950 (EGF)
   05219 Bladder cancer
    1950 (EGF)
   05215 Prostate cancer
    1950 (EGF)
   05213 Endometrial cancer
    1950 (EGF)
   05224 Breast cancer
    1950 (EGF)
   05223 Non-small cell lung cancer
    1950 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1950 (EGF)
   05165 Human papillomavirus infection
    1950 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    1950 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1950 (EGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1950 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF EGF_CA cEGF DUF5050 EGF_3
Other DBs
NCBI-GeneID: 1950
NCBI-ProteinID: NP_001954
OMIM: 131530
HGNC: 3229
Ensembl: ENSG00000138798
Vega: OTTHUMG00000132044
Pharos: P01133(Tbio)
UniProt: P01133
LinkDB
Structure
PDB: 

Position
4q25
AA seq 1207 aa
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagtttcaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctcgcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacattcttttaagtgctttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtgggagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcataatttgtttgcaatgtccctttttggtgaccgtatcttc
tattcaacatggaaaatgaagacaatttggatagccaacaaacacactggaaaggacatg
gttagaattaacctccattcatcatttgtaccacttggtgaactgaaagtagtgcatcca
cttgcacaacccaaggcagaagatgacacttgggagcctgagcagaaactttgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacctccagtcacacttgtgcatg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acgtgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccacgcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacccgataatggtggatgtagccagctctgcgttcctcttagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggatgaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatgggaaacgttccaaaataatcactaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgtctggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtactggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagcagtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaaaagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcatgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggttatgtctgccggtgctca
gaaggctaccaaggagatgggattcactgtcttgatattgatgagtgccaactgggggag
cacagctgtggagagaatgccagctgcacaaatacagagggaggctatacctgcatgtgt
gctggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattccgtaagaaatagtgactctgaatgtcccctgtcccac
gatgggtactgcctccatgatggtgtgtgcatgtatattgaagcattggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcagaaggtcatcgtggtggctgtctgcgtg
gtggtgcttgtcatgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcgaaaaacccaaagaatccttatgaggagtcgagcagagatgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
ataaaagaacaccaagacctcaagaatgggggtcaaccagtggctggtgaggatggccag
gcagcagatgggtcaatgcaaccaacttcatggaggcaggagccccagttatgtggaatg
ggcacagagcaaggctgctggattccagtatccagtgataagggctcctgtccccaggta
atggagcgaagctttcatatgccctcctatgggacacagacccttgaagggggtgtcgag
aagccccattctctcctatcagctaacccattatggcaacaaagggccctggacccacca
caccaaatggagctgactcagtga

KEGG   Homo sapiens (human): 2254
Entry
2254              CDS       T01001                                 

Symbol
FGF9, FGF-9, GAF, HBFG-9, HBGF-9, SYNS3
Name
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06227  Nuclear receptor signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00484  Multiple synostosis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2254 (FGF9)
   04014 Ras signaling pathway
    2254 (FGF9)
   04015 Rap1 signaling pathway
    2254 (FGF9)
   04020 Calcium signaling pathway
    2254 (FGF9)
   04151 PI3K-Akt signaling pathway
    2254 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2254 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2254 (FGF9)
   05207 Chemical carcinogenesis - receptor activation
    2254 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    2254 (FGF9)
   05218 Melanoma
    2254 (FGF9)
   05224 Breast cancer
    2254 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2254 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2254 (FGF9)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2254 (FGF9)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2254 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 2254
NCBI-ProteinID: NP_002001
OMIM: 600921
HGNC: 3687
Ensembl: ENSG00000102678
Vega: OTTHUMG00000017412
Pharos: P31371(Tbio)
UniProt: P31371
LinkDB
Structure
PDB: 
1IHK 5W59 1G82

Position
13q12.11
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggctccccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttc
gaagaaaactggtataatacgtactcatcaaacctatataagcacgtggacactggaagg
cgatactatgttgcattaaataaagatgggaccccgagagaagggactaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaactg
tataaggatattctaagccaaagttga

KEGG   Homo sapiens (human): 28514
Entry
28514             CDS       T01001                                 

Symbol
DLL1, DELTA1, DL1, Delta, NEDBAS
Name
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H02470  Neurodevelopmental disorder with structural brain abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    28514 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    28514 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    28514 (DLL1)
   05207 Chemical carcinogenesis - receptor activation
    28514 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    28514 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    28514 (DLL1)
SSDB
Motif
Pfam: EGF MNNL hEGF DSL EGF_2 EGF_3 EGF_CA ECSCR
Other DBs
NCBI-GeneID: 28514
NCBI-ProteinID: NP_005609
OMIM: 606582
HGNC: 2908
Ensembl: ENSG00000198719
Vega: OTTHUMG00000016078
Pharos: O00548(Tbio)
UniProt: O00548 A0A384P5C6
LinkDB
Structure
PDB: 
4XBM

Position
6q27
AA seq 723 aa
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgggcagtcggtgcgcgctggccctggcggtgctctcggccttgctgtgtcaggtctgg
agctctggggtgttcgaactgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccaccgccgtgcgcctgccggaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagccgccctgcacctacggc
agcgccgtcacccccgtgctgggcgtcgactccttcagtctgcccgacggcgggggcgcc
gactccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tctctgattattgaagctctccacacagattctcctgatgacctcgcaacagaaaaccca
gaaagactcatcagccgcctggccacccagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacggacctcaagtactcctaccgcttcgtgtgtgac
gaacactactacggagagggctgctccgttttctgccgtccccgggacgatgccttcggc
cacttcacctgtggggagcgtggggagaaagtgtgcaaccctggctggaaagggccctac
tgcacagagccgatctgcctgcctggatgtgatgagcagcatggattttgtgacaaacca
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgacgagtgtatccgctat
ccaggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggagccacctgcaccaacacgggccaggggagctacacttgctcttgccggcctgggtac
acaggtgccacctgcgagctggggattgacgagtgtgaccccagcccttgtaagaacgga
gggagctgcacggatctcgagaacagctactcctgtacctgcccacccggcttctacggc
aaaatctgtgaattgagtgccatgacctgtgcggacggcccttgctttaacgggggtcgg
tgctcagacagccccgatggagggtacagctgccgctgccccgtgggctactccggcttc
aactgtgagaagaaaattgactactgcagctcttcaccctgttctaatggtgccaagtgt
gtggacctcggtgatgcctacctgtgccgctgccaggccggcttctcggggaggcactgt
gacgacaacgtggacgactgcgcctcctccccgtgcgccaacgggggcacctgccgggat
ggcgtgaacgacttctcctgcacctgcccgcctggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgcgagcacgcaccctgccacaatggggccacctgccacgagaggggc
caccgctatgtgtgcgagtgtgcccgaggctacgggggtcccaactgccagttcctgctc
cccgagctgcccccgggcccagcggtggtggacctcactgagaagctagagggccagggc
gggccattcccctgggtggccgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgctgtggtggtctgcgtccggctgaggctgcagaagcaccggcccccagcc
gacccctgccggggggagacggagaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcatcatcggggccacgcagatcaagaacaccaacaagaaggcggac
ttccacggggaccacagcgccgacaagaatggcttcaaggcccgctacccagcggtggac
tataacctcgtgcaggacctcaagggtgacgacaccgccgtcagggacgcgcacagcaag
cgtgacaccaagtgccagccccagggctcctcaggggaggagaaggggaccccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggactcgggctgttcaacttcaaaa
gacaccaagtaccagtcggtgtacgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

KEGG   Homo sapiens (human): 10683
Entry
10683             CDS       T01001                                 

Symbol
DLL3, SCDO1
Name
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00517  Spondylocostal dysostosis
Drug target
Rovalpituzumab: D11117
Rovalpituzumab tesirine: D10981
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    10683 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    10683 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    10683 (DLL3)
   05207 Chemical carcinogenesis - receptor activation
    10683 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    10683 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    10683 (DLL3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 DSL
Other DBs
NCBI-GeneID: 10683
NCBI-ProteinID: NP_058637
OMIM: 602768
HGNC: 2909
Ensembl: ENSG00000090932
Vega: OTTHUMG00000183067
Pharos: Q9NYJ7(Tbio)
UniProt: Q9NYJ7
LinkDB
Position
19q13.2
AA seq 618 aa
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
GQRQHLLFPYPSSILSVK
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggtctccccacggatgtccgggctcctctcccagactgtgatcctagcgctcattttc
ctcccccagacacggcccgctggcgtcttcgagctgcagatccactctttcgggccgggt
ccaggccctggggccccgcggtccccctgcagcgcccggctcccctgccgcctcttcttc
agagtctgcctgaagcctgggctctcagaggaggccgccgagtccccgtgcgccctgggc
gcggcgctgagtgcgcgcggaccggtctacaccgagcagcccggagcgcccgcgcctgat
ctcccactgcccgacggcctcttgcaggtgcccttccgggacgcctggcctggcaccttc
tctttcatcatcgaaacctggagagaggagttaggagaccagattggagggcccgcctgg
agcctgctggcgcgcgtggctggcaggcggcgcttggcagccggaggcccgtgggcccgg
gacattcagcgcgcaggcgcctgggagctgcgcttctcgtaccgcgcgcgctgcgagccg
cctgccgtcgggaccgcgtgcacgcgcctctgccgtccgcgcagcgccccctcgcggtgc
ggtccgggactgcgcccctgcgcaccgctcgaggacgaatgtgaggcgccgctggtgtgc
cgagcaggctgcagccctgagcatggcttctgtgaacagcccggtgaatgccgatgccta
gagggctggactggacccctctgcacggtccctgtctccaccagcagctgcctcagcccc
aggggcccgtcctctgctaccaccggatgccttgtccctgggcctgggccctgtgacggg
aacccgtgtgccaatggaggcagctgtagtgagacacccaggtcctttgaatgcacctgc
ccgcgtgggttctacgggctgcggtgtgaggtgagcggggtgacatgtgcagatggaccc
tgcttcaacggcggcttgtgtgtcgggggtgcagaccctgactctgcctacatctgccac
tgcccacccggtttccaaggctccaactgtgagaagagggtggaccggtgcagcctgcag
ccatgccgcaatggcggactctgcctggacctgggccacgccctgcgctgccgctgccgc
gccggcttcgcgggtcctcgctgcgagcacgacctggacgactgcgcgggccgcgcctgc
gctaacggcggcacgtgtgtggagggcggcggcgcgcaccgctgctcctgcgcgctgggc
ttcggcggccgcgactgccgcgagcgcgcggacccgtgcgccgcgcgcccctgtgctcac
ggcggccgctgctacgcccacttctccggcctcgtctgcgcttgcgctcccggctacatg
ggagcgcggtgtgagttcccagtgcaccccgacggcgcaagcgccttgcccgcggccccg
ccgggcctcaggcccggggaccctcagcgctaccttttgcctccggctctgggactgctc
gtggccgcgggcgtggccggcgctgcgctcttgctggtccacgtgcgccgccgtggccac
tcccaggatgctgggtctcgcttgctggctgggaccccggagccgtcagtccacgcactc
ccggatgcactcaacaacctaaggacgcaggagggttccggggatggtccgagctcgtcc
gtagattggaatcgccctgaagatgtagaccctcaagggatttatgtcatatctgctcct
tccatctacgctcgggaggtagcgacgccccttttccccccgctacacactgggcgcgct
gggcagaggcagcacctgctttttccctacccttcctcgattctgtccgtgaaatga

KEGG   Homo sapiens (human): 54567
Entry
54567             CDS       T01001                                 

Symbol
DLL4, AOS6, delta4, hdelta2
Name
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H01413  Adams-Oliver syndrome
Drug target
Demcizumab: D10353
Dilpacimab: D11642
Enoticumab: D10460
Navicixizumab: D11126
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    54567 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    54567 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54567 (DLL4)
   05207 Chemical carcinogenesis - receptor activation
    54567 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    54567 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54567 (DLL4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 EGF_3 DUF4381 EGF_CA Laminin_EGF
Other DBs
NCBI-GeneID: 54567
NCBI-ProteinID: NP_061947
OMIM: 605185
HGNC: 2910
Ensembl: ENSG00000128917
Vega: OTTHUMG00000172511
Pharos: Q9NR61(Tbio)
UniProt: Q9NR61
LinkDB
Structure
PDB: 
5MVX

Position
15q15.1
AA seq 685 aa
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggcggcagcgtcccggagcgcctctggctgggcgctactgctgctggtggcactttgg
cagcagcgcgcggccggctccggcgtcttccagctgcagctgcaggagttcatcaacgag
cgcggcgtactggccagtgggcggccttgcgagcccggctgccggactttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccggaccctgcaccttcgggaccgtctcc
acgccggtattgggcaccaactccttcgctgtccgggacgacagtagcggcggggggcgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcgctcatcatcgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagatgcactcatc
agcaagatcgccatccagggctccctagctgtgggtcagaactggttattggatgagcaa
accagcaccctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggagacaactgctcccgcctgtgcaagaagcgcaatgaccacttcggccactatgtgtgc
cagccagatggcaacttgtcctgcctgcccggttggactggggaatattgccaacagcct
atctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcctc
tgccgcccaggctggcagggccggctgtgtaacgaatgcatcccccacaatggctgtcgc
cacggcacctgcagcactccctggcaatgtacttgtgatgagggctggggaggcctgttt
tgtgaccaagatctcaactactgcacccaccactccccatgcaagaatggggcaacgtgc
tccaacagtgggcagcgaagctacacctgcacctgtcgcccaggctacactggtgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccactgcctgtgtcctccgggctactatggcctgcattgtgaa
cacagcaccttgagctgcgccgactccccctgcttcaatgggggctcctgccgggagcgc
aaccagggggccaactatgcttgtgaatgtccccccaacttcaccggctccaactgcgag
aagaaagtggacaggtgcaccagcaacccctgtgccaacgggggacagtgcctgaaccga
ggtccaagccgcatgtgccgctgccgtcctggattcacgggcacctactgtgaactccac
gtcagcgactgtgcccgtaacccttgcgcccacggtggcacttgccatgacctggagaat
gggctcatgtgcacctgccctgccggcttctctggccgacgctgtgaggtgcggacatcc
atcgatgcctgtgcctcgagtccctgcttcaacagggccacctgctacaccgacctctcc
acagacacctttgtgtgcaactgcccttatggctttgtgggcagccgctgcgagttcccc
gtgggcttgccgcccagcttcccctgggtggccgtctcgctgggtgtggggctggcagtg
ctgctggtactgctgggcatggtggcagtggctgtgcggcagctgcggcttcgacggccg
gacgacggcagcagggaagccatgaacaacttgtcggacttccagaaggacaacctgatt
cctgccgcccagcttaaaaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacagcaaaaccacacattggactataatctggccccaggg
cccctggggcgggggaccatgccaggaaagtttccccacagtgacaagagcttaggagag
aaggcgccactgcggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaggagaggaatgaatgtgtc
attgccacggaggtataa

DBGET integrated database retrieval system