KEGG   Homo sapiens (human): 894
Entry
894               CDS       T01001                                 
Symbol
CCND2, KIAK0002, MPPH3
Name
(RefSeq) cyclin D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04630  JAK-STAT signaling pathway
hsa04917  Prolactin signaling pathway
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06230  Cell cycle
nt06240  Transcription
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06273  Glioma
nt06276  Chronic myeloid leukemia
  Element
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00123  Amplified REL to transcription
N00124  IGH-MAF fusion to transcriptional activation
N00125  IGH-MMSET fusion to transcriptional activation
N00347  p300-p21-Cell cycle G1/S
N00483  EBV EBNA3C to cell cycle G1/S
N00489  HTLV-1 p30II to c-myc-mediated transcription
Disease
H00023  Testicular cancer
H01885  Megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    894 (CCND2)
   04340 Hedgehog signaling pathway
    894 (CCND2)
   04390 Hippo signaling pathway
    894 (CCND2)
   04630 JAK-STAT signaling pathway
    894 (CCND2)
   04068 FoxO signaling pathway
    894 (CCND2)
   04151 PI3K-Akt signaling pathway
    894 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    894 (CCND2)
   04115 p53 signaling pathway
    894 (CCND2)
   04218 Cellular senescence
    894 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    894 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    894 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    894 (CCND2)
   05202 Transcriptional misregulation in cancer
    894 (CCND2)
   05206 MicroRNAs in cancer
    894 (CCND2)
   05203 Viral carcinogenesis
    894 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    894 (CCND2)
   05162 Measles
    894 (CCND2)
   05169 Epstein-Barr virus infection
    894 (CCND2)
   05165 Human papillomavirus infection
    894 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 894
NCBI-ProteinID: NP_001750
OMIM: 123833
HGNC: 1583
Ensembl: ENSG00000118971
Vega: OTTHUMG00000168123
Pharos: P30279(Tbio)
UniProt: P30279
Structure
LinkDB
Position
12:4273762..4305353
AA seq 289 aa
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDV
DCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgccacgaggtggacccggtccgcagggccgtgcgggaccgcaacctg
ctccgagacgaccgcgtcctgcagaacctgctcaccatcgaggagcgctaccttccgcag
tgctcctacttcaagtgcgtgcagaaggacatccaaccctacatgcgcagaatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgcgaagaagaggtcttccctctggcc
atgaattacctggaccgtttcttggctggggtcccgactccgaagtcccatctgcaactc
ctgggtgctgtctgcatgttcctggcctccaaactcaaagagaccagcccgctgaccgcg
gagaagctgtgcatttacaccgacaactccatcaagcctcaggagctgctggagtgggaa
ctggtggtgctggggaagttgaagtggaacctggcagctgtcactcctcatgacttcatt
gagcacatcttgcgcaagctgccccagcagcgggagaagctgtctctgatccgcaagcat
gctcagaccttcattgctctgtgtgccaccgactttaagtttgccatgtacccaccgtcg
atgatcgcaactggaagtgtgggagcagccatctgtgggctccagcaggatgaggaagtg
agctcgctcacttgtgatgccctgactgagctgctggctaagatcaccaacacagacgtg
gattgtctcaaagcttgccaggagcagattgaggcggtgctcctcaatagcctgcagcag
taccgtcaggaccaacgtgacggatccaagtcggaggatgaactggaccaagccagcacc
cctacagacgtgcgggatatcgacctgtga

KEGG   Homo sapiens (human): 597
Entry
597               CDS       T01001                                 
Symbol
BCL2A1, ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1
Name
(RefSeq) BCL2 related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00113  PML-RARA fusion to transcriptional repression
N00123  Amplified REL to transcription
Drug target
Navitoclax (DG03204): D09935 D09936
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    597 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    597 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    597 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    597 (BCL2A1)
SSDB
Motif
Pfam: Bcl-2 CCDC24
Other DBs
NCBI-GeneID: 597
NCBI-ProteinID: NP_004040
OMIM: 601056
HGNC: 991
Ensembl: ENSG00000140379
Vega: OTTHUMG00000144173
Pharos: Q16548(Tchem)
UniProt: Q16548
Structure
LinkDB
Position
15:complement(79960892..79971196)
AA seq 175 aa
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
NT seq 528 nt   +upstreamnt  +downstreamnt
atgacagactgtgaatttggatatatttacaggctggctcaggactatctgcagtgcgtc
ctacagataccacaacctggatcaggtccaagcaaaacgtccagagtgctacaaaatgtt
gcgttctcagtccaaaaagaagtggaaaagaatctgaagtcatgcttggacaatgttaat
gttgtgtccgtagacactgccagaacactattcaaccaagtgatggaaaaggagtttgaa
gacggcatcattaactggggaagaattgtaaccatatttgcatttgaaggtattctcatc
aagaaacttctacgacagcaaattgccccggatgtggatacctataaggagatttcatat
tttgttgcggagttcataatgaataacacaggagaatggataaggcaaaacggaggctgg
gaaaatggctttgtaaagaagtttgaacctaaatctggctggatgacttttctagaagtt
acaggaaagatctgtgaaatgctatctctcctgaagcaatactgttga

KEGG   Homo sapiens (human): 330
Entry
330               CDS       T01001                                 
Symbol
BIRC3, AIP1, API2, CIAP2, HAIP1, HIAP1, IAP-1, MALT2, MIHC, RNF49, c-IAP2
Name
(RefSeq) baculoviral IAP repeat containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05145  Toxoplasmosis
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05222  Small cell lung cancer
Network
nt06123  TNF signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    330 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    330 (BIRC3)
   04064 NF-kappa B signaling pathway
    330 (BIRC3)
   04668 TNF signaling pathway
    330 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    330 (BIRC3)
   04215 Apoptosis - multiple species
    330 (BIRC3)
   04217 Necroptosis
    330 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    330 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    330 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    330 (BIRC3)
   05202 Transcriptional misregulation in cancer
    330 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    330 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    330 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    330 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    330 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    330 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    330 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    330 (BIRC3)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   330 (BIRC3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    330 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 DUF2039 zf-C3HC4_2 OTT_1508_deam
Other DBs
NCBI-GeneID: 330
NCBI-ProteinID: NP_001156
OMIM: 601721
HGNC: 591
Ensembl: ENSG00000023445
Vega: OTTHUMG00000167324
Pharos: Q13489(Tchem)
UniProt: Q13489
Structure
LinkDB
Position
11:102317484..102339403
AA seq 604 aa
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaacagcatattcttatcaaatttgatgaaaagcgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtctcagaaaggagtcttgctcgtgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaaagaggagac
agtcctactgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tccgttaacaacttggaagctacctctcagcctacttttccttcttcagtaacaaattcc
acacactcattacttccgggtacagaaaacagtggatatttccgtggctcttattcaaac
tctccatcaaatcctgtaaactccagagcaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataacgaaaatgccagattacttacttttcagacatggcca
ttgacttttctgtcgccaacagatctggcaaaagcaggcttttactacataggacctgga
gacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaaccgaaggataat
gctatgtcagaacacctgagacattttcccaaatgcccatttatagaaaatcagcttcaa
gacacttcaagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatcctgagcagcttgcaagtgcgggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggttcaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatccgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatccacatcagacagcccaggagatgaaaatgcagagtcatca
attatccattttgaacctggagaagaccattcagaagatgcaatcatgatgaatactcct
gtgattaatgctgccgtggaaatgggctttagtagaagcctggtaaaacagacagttcag
agaaaaatcctagcaactggagagaattatagactagtcaatgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccggaattattaatgaacaagaacatgat
gttattaaacagaagacacagacgtctttacaagcaagagaactgattgatacgatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgaagctgtg
ttatatgagcatttatttgtgcaacaggacataaaatatattcccacagaagatgtttca
gatctaccagtggaagaacaattgcggagactacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgctccttctttaagaaagtgtcctatttgtaggagtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Homo sapiens (human): 7185
Entry
7185              CDS       T01001                                 
Symbol
TRAF1, EBI6, MGC:10353
Name
(RefSeq) TNF receptor associated factor 1
  KO
K03172  TNF receptor-associated factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04210  Apoptosis
hsa04668  TNF signaling pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7185 (TRAF1)
   04668 TNF signaling pathway
    7185 (TRAF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7185 (TRAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7185 (TRAF1)
   05202 Transcriptional misregulation in cancer
    7185 (TRAF1)
   05203 Viral carcinogenesis
    7185 (TRAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    7185 (TRAF1)
SSDB
Motif
Pfam: TRAF_BIRC3_bd PilJ Not3
Other DBs
NCBI-GeneID: 7185
NCBI-ProteinID: NP_001177874
OMIM: 601711
HGNC: 12031
Ensembl: ENSG00000056558
Vega: OTTHUMG00000020578
Pharos: Q13077(Tbio)
UniProt: Q13077
Structure
LinkDB
Position
9:complement(120902393..120929171)
AA seq 416 aa
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcctccagctcaggcagcagtcctcgcccggcccctgatgagaatgagtttcccttt
gggtgccctcccaccgtctgccaggacccaaaggagcccagggctctctgctgtgcaggc
tgtctctctgagaacccgaggaatggcgaggatcagatctgccccaaatgcagaggggaa
gacctccagtctataagcccaggaagccgtcttcgaactcaggagaaggctcaccccgag
gtggctgaggctggaattgggtgcccctttgcaggtgtcggctgctccttcaagggaagc
ccacagtctgtgcaagagcatgaggtcacctcccagacctcccacctaaacctgctgttg
gggttcatgaaacagtggaaggcccggctgggctgtggcctggagtctgggcccatggcc
ctggagcagaacctgtcagacctgcagctgcaggcagccgtggaagtggcgggggacctg
gaggtcgattgctaccgggcaccctgctccgagagccaggaggagctggccctgcagcac
ttcatgaaggagaagcttctggctgagctggaggggaagctgcgtgtgtttgagaacatt
gttgctgtcctcaacaaggaggtggaggcctcccacctggccctggccacctctatccac
cagagccagctggaccgtgagcgcatcctgagcttggagcagagggtggtggagcttcag
cagaccctggcccagaaagaccaggccctgggcaagctggagcagagcttgcgcctcatg
gaggaggcctccttcgatggcactttcctgtggaagatcaccaatgtcaccaggcggtgc
catgagtcggcctgtggcaggaccgtcagcctcttctccccagccttctacactgccaag
tatggctacaagttgtgcctgcggctgtacctgaatggagatggcactggaaagagaacc
catctgtcgctcttcatcgtgatcatgagaggggagtatgatgcgctgctgccgtggccc
ttccggaacaaggtcaccttcatgctgctggaccagaacaaccgtgagcacgccattgac
gccttccggcctgacctaagctcagcgtccttccagaggccccagagtgaaaccaacgtg
gccagtggatgcccactcttcttccccctcagcaaactgcagtcacccaagcacgcctac
gtgaaggacgacacaatgttcctcaagtgcattgtggagaccagcacttag

KEGG   Homo sapiens (human): 598
Entry
598               CDS       T01001                                 
Symbol
BCL2L1, BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52
Name
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01524  Platinum drug resistance
hsa04014  Ras signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04115  p53 signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04621  NOD-like receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05212  Pancreatic cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05225  Hepatocellular carcinoma
hsa05417  Lipid and atherosclerosis
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06219  JAK-STAT signaling
nt06231  Apoptosis
nt06240  Transcription
nt06260  Colorectal cancer
nt06267  Small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06414  Apoptosis
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N00098  Intrinsic apoptotic pathway
N00123  Amplified REL to transcription
N00451  HIV Tat to intrinsic apoptotic pathway
N01051  Mutation-inactivated DJ1 to intrinsic apoptotic pathway
Drug target
Navitoclax (DG03204): D09935 D09936
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    598 (BCL2L1)
   04630 JAK-STAT signaling pathway
    598 (BCL2L1)
   04064 NF-kappa B signaling pathway
    598 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    598 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    598 (BCL2L1)
   04137 Mitophagy - animal
    598 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    598 (BCL2L1)
   04215 Apoptosis - multiple species
    598 (BCL2L1)
   04115 p53 signaling pathway
    598 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    598 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    598 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    598 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    598 (BCL2L1)
   05225 Hepatocellular carcinoma
    598 (BCL2L1)
   05220 Chronic myeloid leukemia
    598 (BCL2L1)
   05222 Small cell lung cancer
    598 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    598 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    598 (BCL2L1)
   05162 Measles
    598 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    598 (BCL2L1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    598 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    598 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    598 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    598 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    598 (BCL2L1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    598 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    598 (BCL2L1)
   01524 Platinum drug resistance
    598 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    598 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    598 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    598 (BCL2L1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     598 (BCL2L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    598 (BCL2L1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   598 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 598
NCBI-ProteinID: NP_001304848
OMIM: 600039
HGNC: 992
Ensembl: ENSG00000171552
Vega: OTTHUMG00000032192
Pharos: Q07817(Tchem)
UniProt: Q07817 A0A0S2Z3C5
Structure
LinkDB
Position
20:complement(31664452..31723963)
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggca
gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg
atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg
taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca
gccgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg
gccggcgtggttctgctgggctcactcttcagtcggaaatga

KEGG   Homo sapiens (human): 942
Entry
942               CDS       T01001                                 
Symbol
CD86, B7-2, B7.2, B70, CD28LG2, LAB72
Name
(RefSeq) CD86 molecule
  KO
K05413  CD86 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06114  PI3K signaling (viruses)
nt06129  MHC presentation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06169  Measles virus (MV)
nt06229  MHC presentation
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
N00185  KSHV MIR2 to cell surface molecule-endocytosis
N00683  CD80/CD86-CD28-PI3K signaling pathway
Drug target
Abatacept: D03203<JP/US>
Belatacept: D03222<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    942 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    942 (CD86)
   04672 Intestinal immune network for IgA production
    942 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    942 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    942 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    942 (CD86)
   05323 Rheumatoid arthritis
    942 (CD86)
   05320 Autoimmune thyroid disease
    942 (CD86)
   05330 Allograft rejection
    942 (CD86)
   05332 Graft-versus-host disease
    942 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    942 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    942 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    942 (CD86)
   04090 CD molecules [BR:hsa04090]
    942 (CD86)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   942 (CD86)
CD molecules [BR:hsa04090]
 Proteins
  942 (CD86)
SSDB
Motif
Pfam: Ig_2 V-set Ig_3 LAX I-set ig C2-set_2 DUF4381
Other DBs
NCBI-GeneID: 942
NCBI-ProteinID: NP_787058
OMIM: 601020
HGNC: 1705
Ensembl: ENSG00000114013
Vega: OTTHUMG00000159482
Pharos: P42081(Tclin)
UniProt: P42081 A8K632
Structure
LinkDB
Position
3:122055362..122121136
AA seq 329 aa
MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF
NT seq 990 nt   +upstreamnt  +downstreamnt
atggatccccagtgcactatgggactgagtaacattctctttgtgatggccttcctgctc
tctggtgctgctcctctgaagattcaagcttatttcaatgagactgcagacctgccatgc
caatttgcaaactctcaaaaccaaagcctgagtgagctagtagtattttggcaggaccag
gaaaacttggttctgaatgaggtatacttaggcaaagagaaatttgacagtgttcattcc
aagtatatgggccgcacaagttttgattcggacagttggaccctgagacttcacaatctt
cagatcaaggacaagggcttgtatcaatgtatcatccatcacaaaaagcccacaggaatg
attcgcatccaccagatgaattctgaactgtcagtgcttgctaacttcagtcaacctgaa
atagtaccaatttctaatataacagaaaatgtgtacataaatttgacctgctcatctata
cacggttacccagaacctaagaagatgagtgttttgctaagaaccaagaattcaactatc
gagtatgatggtgttatgcagaaatctcaagataatgtcacagaactgtacgacgtttcc
atcagcttgtctgtttcattccctgatgttacgagcaatatgaccatcttctgtattctg
gaaactgacaagacgcggcttttatcttcacctttctctatagagcttgaggaccctcag
cctcccccagaccacattccttggattacagctgtacttccaacagttattatatgtgtg
atggttttctgtctaattctatggaaatggaagaagaagaagcggcctcgcaactcttat
aaatgtggaaccaacacaatggagagggaagagagtgaacagaccaagaaaagagaaaaa
atccatatacctgaaagatctgatgaagcccagcgtgtttttaaaagttcgaagacatct
tcatgcgacaaaagtgatacatgtttttaa

KEGG   Homo sapiens (human): 958
Entry
958               CDS       T01001                                 
Symbol
CD40, Bp50, CDW40, TNFRSF5, p50
Name
(RefSeq) CD40 molecule
  KO
K03160  tumor necrosis factor receptor superfamily member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules
hsa04620  Toll-like receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05202  Transcriptional misregulation in cancer
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
hsa05340  Primary immunodeficiency
hsa05416  Viral myocarditis
hsa05417  Lipid and atherosclerosis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06223  TNF signaling
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
N00505  CD40-NFKB signaling pathway
Disease
H00086  Hyper IgM syndromes, autosomal recessive type
H00093  Combined immunodeficiency
Drug target
Bleselumab: D11357
Dacetuzumab: D08896
Iscalimab: D11610
Lucatumumab: D08942
Ravagalimab: D11597
Selicrelumab: D11491
Sotigalimab: D12178
Teneliximab: D06071
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    958 (CD40)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    958 (CD40)
   04514 Cell adhesion molecules
    958 (CD40)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    958 (CD40)
   04672 Intestinal immune network for IgA production
    958 (CD40)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    958 (CD40)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    958 (CD40)
   05169 Epstein-Barr virus infection
    958 (CD40)
  09174 Infectious disease: parasitic
   05144 Malaria
    958 (CD40)
   05145 Toxoplasmosis
    958 (CD40)
  09163 Immune disease
   05310 Asthma
    958 (CD40)
   05322 Systemic lupus erythematosus
    958 (CD40)
   05320 Autoimmune thyroid disease
    958 (CD40)
   05330 Allograft rejection
    958 (CD40)
   05340 Primary immunodeficiency
    958 (CD40)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    958 (CD40)
   05416 Viral myocarditis
    958 (CD40)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    958 (CD40)
   04090 CD molecules [BR:hsa04090]
    958 (CD40)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   958 (CD40)
CD molecules [BR:hsa04090]
 Proteins
  958 (CD40)
SSDB
Motif
Pfam: TNFR_c6 RANK_CRD_2 DUF6479 Glycophorin_A DUF2207 Syndecan
Other DBs
NCBI-GeneID: 958
NCBI-ProteinID: NP_001241
OMIM: 109535
HGNC: 11919
Ensembl: ENSG00000101017
Vega: OTTHUMG00000033053
Pharos: P25942(Tchem)
UniProt: P25942 Q6P2H9 A0A0S2Z3C7
Structure
LinkDB
Position
20:46118314..46129858
AA seq 277 aa
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV
LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN
KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD
DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
NT seq 834 nt   +upstreamnt  +downstreamnt
atggttcgtctgcctctgcagtgcgtcctctggggctgcttgctgaccgctgtccatcca
gaaccacccactgcatgcagagaaaaacagtacctaataaacagtcagtgctgttctttg
tgccagccaggacagaaactggtgagtgactgcacagagttcactgaaacggaatgcctt
ccttgcggtgaaagcgaattcctagacacctggaacagagagacacactgccaccagcac
aaatactgcgaccccaacctagggcttcgggtccagcagaagggcacctcagaaacagac
accatctgcacctgtgaagaaggctggcactgtacgagtgaggcctgtgagagctgtgtc
ctgcaccgctcatgctcgcccggctttggggtcaagcagattgctacaggggtttctgat
accatctgcgagccctgcccagtcggcttcttctccaatgtgtcatctgctttcgaaaaa
tgtcacccttggacaagctgtgagaccaaagacctggttgtgcaacaggcaggcacaaac
aagactgatgttgtctgtggtccccaggatcggctgagagccctggtggtgatccccatc
atcttcgggatcctgtttgccatcctcttggtgctggtctttatcaaaaaggtggccaag
aagccaaccaataaggccccccaccccaagcaggaaccccaggagatcaattttcccgac
gatcttcctggctccaacactgctgctccagtgcaggagactttacatggatgccaaccg
gtcacccaggaggatggcaaagagagtcgcatctcagtgcaggagagacagtga

DBGET integrated database retrieval system