KEGG   Homo sapiens (human): 6772Help
Entry
6772              CDS       T01001                                 

Gene name
STAT1, CANDF7, IMD31A, IMD31B, IMD31C, ISGF-3, STAT91
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (virus)
nt06122  IFN signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06219  JAK-STAT signaling
nt06222  IFN signaling
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00486  EBV LMP1 to Jak-STAT signaling pathway
N00558  HBV pol to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
H00363  Candidiasis
H01109  Chronic mucocutaneous candidiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    6772 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6772 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6772 (STAT1)
   04621 NOD-like receptor signaling pathway
    6772 (STAT1)
   04625 C-type lectin receptor signaling pathway
    6772 (STAT1)
   04658 Th1 and Th2 cell differentiation
    6772 (STAT1)
   04659 Th17 cell differentiation
    6772 (STAT1)
   04062 Chemokine signaling pathway
    6772 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    6772 (STAT1)
   04919 Thyroid hormone signaling pathway
    6772 (STAT1)
  09158 Development
   04380 Osteoclast differentiation
    6772 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6772 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    6772 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    6772 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    6772 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6772 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    6772 (STAT1)
  09172 Infectious disease: viral
   05162 Measles
    6772 (STAT1)
   05164 Influenza A
    6772 (STAT1)
   05161 Hepatitis B
    6772 (STAT1)
   05160 Hepatitis C
    6772 (STAT1)
   05168 Herpes simplex virus 1 infection
    6772 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6772 (STAT1)
   05169 Epstein-Barr virus infection
    6772 (STAT1)
   05165 Human papillomavirus infection
    6772 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    6772 (STAT1)
   05140 Leishmaniasis
    6772 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6772 (STAT1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6772 (STAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 TRPM_tetra BLI1
Motif
Other DBs
NCBI-GeneID: 6772
NCBI-ProteinID: NP_009330
OMIM: 600555
HGNC: 11362
Ensembl: ENSG00000115415
Vega: OTTHUMG00000132699
Pharos: P42224(Tchem)
UniProt: P42224
LinkDB All DBs
Structure
PDB: 

Position
2q32.2
AA seq 750 aa AA seqDB search
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggtacgaacttcagcagcttgactcaaaattcctggagcaggttcaccag
ctttatgatgacagttttcccatggaaatcagacagtacctggcacagtggttagaaaag
caagactgggagcacgctgccaatgatgtttcatttgccaccatccgttttcatgacctc
ctgtcacagctggatgatcaatatagtcgcttttctttggagaataacttcttgctacag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatccag
atgtctatgatcatttacagctgtctgaaggaagaaaggaaaattctggaaaacgcccag
agatttaatcaggctcagtcggggaatattcagagcacagtgatgttagacaaacagaaa
gagcttgacagtaaagtcagaaatgtgaaggacaaggttatgtgtatagagcatgaaatc
aagagcctggaagatttacaagatgaatatgacttcaaatgcaaaaccttgcagaacaga
gaacacgagaccaatggtgtggcaaagagtgatcagaaacaagaacagctgttactcaag
aagatgtatttaatgcttgacaataagagaaaggaagtagttcacaaaataatagagttg
ctgaatgtcactgaacttacccagaatgccctgattaatgatgaactagtggagtggaag
cggagacagcagagcgcctgtattggggggccgcccaatgcttgcttggatcagctgcag
aactggttcactatagttgcggagagtctgcagcaagttcggcagcagcttaaaaagttg
gaggaattggaacagaaatacacctacgaacatgaccctatcacaaaaaacaaacaagtg
ttatgggaccgcaccttcagtcttttccagcagctcattcagagctcgtttgtggtggaa
agacagccctgcatgccaacgcaccctcagaggccgctggtcttgaagacaggggtccag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgataaagatgtgaatgagagaaatacagtaaaaggatttaggaagttc
aacattttgggcacgcacacaaaagtgatgaacatggaggagtccaccaatggcagtctg
gcggctgaatttcggcacctgcaattgaaagaacagaaaaatgctggcaccagaacgaat
gagggtcctctcatcgttactgaagagcttcactcccttagttttgaaacccaattgtgc
cagcctggtttggtaattgacctcgagacgacctctctgcccgttgtggtgatctccaac
gtcagccagctcccgagcggttgggcctccatcctttggtacaacatgctggtggcggaa
cccaggaatctgtccttcttcctgactccaccatgtgcacgatgggctcagctttcagaa
gtgctgagttggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgttgggagagaagcttcttggtcctaacgccagccccgatggtctcattccgtggacg
aggttttgtaaggaaaatataaatgataaaaattttcccttctggctttggattgaaagc
atcctagaactcattaaaaaacacctgctccctctctggaatgatgggtgcatcatgggc
ttcatcagcaaggagcgagagcgtgccctgttgaaggaccagcagccggggaccttcctg
ctgcggttcagtgagagctcccgggaaggggccatcacattcacatgggtggagcggtcc
cagaacggaggcgaacctgacttccatgcggttgaaccctacacgaagaaagaactttct
gctgttactttccctgacatcattcgcaattacaaagtcatggctgctgagaatattcct
gagaatcccctgaagtatctgtatccaaatattgacaaagaccatgcctttggaaagtat
tactccaggccaaaggaagcaccagagccaatggaacttgatggccctaaaggaactgga
tatatcaagactgagttgatttctgtgtctgaagttcacccttctagacttcagaccaca
gacaacctgctccccatgtctcctgaggagtttgacgaggtgtctcggatagtgggctct
gtagaattcgacagtatgatgaacacagtatag

KEGG   Homo sapiens (human): 6773Help
Entry
6773              CDS       T01001                                 

Gene name
STAT2, IMD44, ISGF-3, P113, STAT113
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06122  IFN signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06219  JAK-STAT signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00558  HBV pol to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    6773 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6773 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6773 (STAT2)
   04625 C-type lectin receptor signaling pathway
    6773 (STAT2)
   04062 Chemokine signaling pathway
    6773 (STAT2)
  09158 Development
   04380 Osteoclast differentiation
    6773 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6773 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    6773 (STAT2)
   05164 Influenza A
    6773 (STAT2)
   05161 Hepatitis B
    6773 (STAT2)
   05160 Hepatitis C
    6773 (STAT2)
   05168 Herpes simplex virus 1 infection
    6773 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6773 (STAT2)
   05169 Epstein-Barr virus infection
    6773 (STAT2)
   05165 Human papillomavirus infection
    6773 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6773 (STAT2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6773 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 CorA
Motif
Other DBs
NCBI-GeneID: 6773
NCBI-ProteinID: NP_005410
OMIM: 600556
HGNC: 11363
Ensembl: ENSG00000170581
Vega: OTTHUMG00000170760
Pharos: P52630(Tbio)
UniProt: P52630 R9QE65
LinkDB All DBs
Structure
PDB: 

Position
12q13.3
AA seq 851 aa AA seqDB search
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggaaatgctgcagaatcttgacagcccctttcaggatcagctgcaccag
ctttactcgcacagcctcctgcctgtggacattcgacagtacttggctgtctggattgaa
gaccagaactggcaggaagctgcacttgggagtgatgattccaaggctaccatgctattc
ttccacttcttggatcagctgaactatgagtgtggccgttgcagccaggacccagagtcc
ttgttgctgcagcacaatttgcggaaattctgccgggacattcagcccttttcccaggat
cctacccagttggctgagatgatctttaacctccttctggaagaaaaaagaattttgatc
caggctcagagggcccaattggaacaaggagagccagttctcgaaacacctgtggagagc
cagcaacatgagattgaatcccggatcctggatttaagggctatgatggagaagctggta
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
gccaaagggaagacaccctctctggacccccatcagaccaaagagcagaagattctgcag
gaaactctcaatgaactggacaaaaggagaaaggaggtgctggatgcctccaaagcactg
ctaggccgattaactaccctaatcgagctactgctgccaaagttggaggagtggaaggcc
cagcagcaaaaagcctgcatcagagctcccattgaccacgggttggaacagctggagaca
tggttcacagctggagcaaagctgttgtttcacctgaggcagctgctgaaggagctgaag
ggactgagttgcctggttagctatcaggatgaccctctgaccaaaggggtggacctacgc
aacgcccaggtcacagagttgctacagcgtctgctccacagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactggcagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgtggaa
gtctccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgact
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggtttgatttgggacttt
ggttacctgactctggtggagcaacgttcaggtggttcaggaaagggcagcaataagggg
ccactaggtgtgacagaggaactgcacatcatcagcttcacggtcaaatatacctaccag
ggtctgaagcaggagctgaaaacggacaccctccctgtggtgattatttccaacatgaac
cagctctcaattgcctgggcttcagttctctggttcaatttgctcagcccaaaccttcag
aaccagcagttcttctccaacccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctatgttggccgaggcctcaactcagaccagctgagcatgctg
agaaacaagctgttcgggcagaactgtaggactgaggatccattattgtcctgggctgac
ttcactaagcgagagagccctcctggcaagttaccattctggacatggctggacaaaatt
ctggagttggtacatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagtcggagccaggagcgccggctgctgaagaagaccatgtctggcacctttctactg
cgcttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggatgat
gacaaggtgctcatctactctgtgcaaccgtacacgaaggaggtgctgcagtcactcccg
ctgactgaaatcatccgccattaccagttgctcactgaggagaatatacctgaaaaccca
ctgcgcttcctctatccccgaatcccccgggatgaagcttttgggtgctactaccaggag
aaagttaatctccaggaacggaggaaatacctgaaacacaggctcattgtggtctctaat
agacaggtggatgaactgcaacaaccgctggagcttaagccagagccagagctggagtca
ttagagctggaactagggctggtgccagagccagagctcagcctggacttagagccactg
ctgaaggcagggctggatctggggccagagctagagtctgtgctggagtccactctggag
cctgtgatagagcccacactatgcatggtatcacaaacagtgccagagccagaccaagga
cctgtatcacagccagtgccagagccagatttgccctgtgatctgagacatttgaacact
gagccaatggaaatcttcagaaactgtgtaaagattgaagaaatcatgccgaatggtgac
ccactgttggctggccagaacaccgtggatgaggtttacgtctcccgccccagccacttc
tacactgatggacccttgatgccttctgacttctag

KEGG   Homo sapiens (human): 6775Help
Entry
6775              CDS       T01001                                 

Gene name
STAT4, SLEB11
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01492  Systemic sclerosis
H01502  Sjogren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    6775 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6775 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    6775 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6775 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    6775 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    6775 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6775 (STAT4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6775 (STAT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 CRC_subunit NPV_P10
Motif
Other DBs
NCBI-GeneID: 6775
NCBI-ProteinID: NP_001230764
OMIM: 600558
HGNC: 11365
Ensembl: ENSG00000138378
Vega: OTTHUMG00000132700
Pharos: Q14765(Tbio)
UniProt: Q14765
LinkDB All DBs
Position
2q32.2-q32.3
AA seq 748 aa AA seqDB search
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaatcaagtttttggagcaggtggatcaa
ttctatgatgacaactttcccatggaaattcggcatctgttggcccaatggattgaaaat
caagactgggaggcagcttctaacaatgaaaccatggcaacgattcttcttcaaaacttg
ttaatacaactggatgaacagttaggtcgtgtttccaaagagaaaaacctactcttgata
cacaatctaaaaagaattaggaaggtccttcagggaaaatttcatggaaatccaatgcat
gtagctgtggttatttcaaactgtttaagggaagagaggagaatattggctgcagccaac
atgcctgtccaggggcctctagagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagatctgcaagacgaatttgactacaggtataaaacaattcagaca
atggatcagagtgacaagaatagtgccatggtgaatcaggaagttttgacactgcaggaa
atgcttaacagcctcgatttcaagagaaaggaggctctcagtaaaatgacccaaatcatc
catgagacagacctgttaatgaacaccatgctcatagaagagctgcaagactggaagcgg
cggcagcaaatcgcctgcatcgggggtccactccacaatgggctcgaccagcttcagaac
tgctttacactattggcagaaagtcttttccaactgagaaggcaattggagaaactagag
gagcaatctaccaaaatgacatatgaaggtgatcccattccaatgcaaagaactcacatg
ctagaaagagtcaccttcttgatctacaaccttttcaagaactcatttgtggttgagcga
cagccatgtatgccaacccaccctcagaggccgttggtacttaaaaccctaattcagttc
actgtaaaactaaggctactaataaaattgccagaactaaactatcaggtaaaggttaag
gcatcaattgacaagaatgtttcaactctaagcaaccgaagatttgtactttgtggaact
aatgtcaaagccatgtctattgaagaatcttccaatgggagtctctcagtagaatttcga
catttgcaaccaaaggaaatgaagtccagtgctggaggtaaaggaaatgagggctgtcac
atggtgactgaagaacttcattccataacgtttgaaacacagatctgcctctatggcctg
accatagatttggagaccagctcattgcctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccatcatttggtacaacgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccacctgccacattgagtcaactactggaggtgatgagctgg
cagttttcatcgtacgttggtcgtggtcttaactcagatcaactccatatgctggcagag
aagcttacagtccaatctagctacagtgatggtcacctcacctgggccaagttctgcaag
gaacatttacctggtaaatcatttaccttttggacatggcttgaagcaatattggatcta
attaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgttagcaaa
gagaaggaacggctgttgctaaaggataaaatgcctggcacctttttattaagattcagt
gaaagccatctcggaggaataactttcacctgggtggaccattctgaaagtggggaagtg
agattccactctgtagaaccctacaataaaggccggttgtctgctctgccattcgctgac
atcctgcgagactacaaagttattatggctgaaaacattcctgaaaaccctctgaagtac
ctatatcctgacattcccaaagacaaagccttcggtaaacactacagctctcagccttgc
gaagtttcaagaccaacagaaaggggtgacaaaggttatgttccttctgtttttatcccc
atctcaacaatccgaagtgattcaacagagccacattctccatcagaccttcttcccatg
tctccaagtgtgtatgcggtgttgagagaaaacctgagtcccacaacaattgaaactgca
atgaagtctccttattctgctgaatga

KEGG   Homo sapiens (human): 6776Help
Entry
6776              CDS       T01001                                 

Gene name
STAT5A, MGF, STAT5
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04217  Necroptosis
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04917  Prolactin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06262  Pancreatic cancer
nt06266  Non-small cell lung cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00054  Duplication or mutation-activated FLT3 to Jak-STAT signaling pathway
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00105  EML4-ALK fusion kinase to Jak-STAT signaling pathway
N00219  FLT3LG-FLT3-STAT5 signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    6776 (STAT5A)
   04630 Jak-STAT signaling pathway
    6776 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6776 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    6776 (STAT5A)
   04659 Th17 cell differentiation
    6776 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    6776 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6776 (STAT5A)
   05203 Viral carcinogenesis
    6776 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    6776 (STAT5A)
   05220 Chronic myeloid leukemia
    6776 (STAT5A)
   05223 Non-small cell lung cancer
    6776 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6776 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6776 (STAT5A)
   05162 Measles
    6776 (STAT5A)
   05161 Hepatitis B
    6776 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6776 (STAT5A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6776 (STAT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 TerB_N
Motif
Other DBs
NCBI-GeneID: 6776
NCBI-ProteinID: NP_001275647
OMIM: 601511
HGNC: 11366
Ensembl: ENSG00000126561
Vega: OTTHUMG00000150725
Pharos: P42229(Tchem)
UniProt: P42229 A0A384N5W4 A8K6I5 Q59GY7
LinkDB All DBs
Position
17q21.2
AA seq 794 aa AA seqDB search
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctgtacggccagcacttccccatcgaggtccggcactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaaaacatatgaccgc
tgccccctggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaattgcagctctccggctgggatcctggttgacgccatgtcccagaag
caccttcagatcaaccagacatttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaaactgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttgcccagctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtacgcctgctggtgggcgggaagctg
aacgtgcacatgaatcccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgcttaaaaatgagaacacccgcaacgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagtgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
actctgtccctacctgtggttgtcatcgtccacggcagccaggaccacaatgccacggct
actgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggtttgacggggtgatggaggtg
ttgaagaagcaccacaagccccactggaatgatggggccatcctaggttttgtgaataag
caacaggcccacgacctgctcatcaacaagcccgacgggaccttcttgttgcgctttagt
gactcagaaatcgggggcatcaccatcgcctggaagtttgactccccggaacgcaacctg
tggaacctgaaaccattcaccacgcgggatttctccatcaggtccctggctgaccggctg
ggggacctgagctatctcatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactacactcctgtgctggctaaagctgttgatggatatgtgaaaccacagatcaag
caagtggtccctgagtttgtgaatgcatctgcagatgctgggggcagcagcgccacgtac
atggaccaggccccctccccagctgtgtgcccccaggctccctataacatgtacccacag
aaccctgaccatgtactcgatcaggatggagaattcgacctggatgagaccatggatgtg
gccaggcacgtggaggaactcttacgccgaccaatggacagtcttgactcccgcctctcg
ccccctgccggtcttttcacctctgccagaggctccctctcatga

KEGG   Homo sapiens (human): 6777Help
Entry
6777              CDS       T01001                                 

Gene name
STAT5B, STAT5
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04917  Prolactin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06262  Pancreatic cancer
nt06266  Non-small cell lung cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00054  Duplication or mutation-activated FLT3 to Jak-STAT signaling pathway
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00105  EML4-ALK fusion kinase to Jak-STAT signaling pathway
N00219  FLT3LG-FLT3-STAT5 signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Disease
H00931  Growth hormone insensitivity with immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    6777 (STAT5B)
   04630 Jak-STAT signaling pathway
    6777 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6777 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    6777 (STAT5B)
   04659 Th17 cell differentiation
    6777 (STAT5B)
   04062 Chemokine signaling pathway
    6777 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    6777 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6777 (STAT5B)
   05203 Viral carcinogenesis
    6777 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    6777 (STAT5B)
   05220 Chronic myeloid leukemia
    6777 (STAT5B)
   05223 Non-small cell lung cancer
    6777 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6777 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6777 (STAT5B)
   05162 Measles
    6777 (STAT5B)
   05161 Hepatitis B
    6777 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6777 (STAT5B)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6777 (STAT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 6777
NCBI-ProteinID: NP_036580
OMIM: 604260
HGNC: 11367
Ensembl: ENSG00000173757
Vega: OTTHUMG00000150724
Pharos: P51692(Tchem)
UniProt: P51692
LinkDB All DBs
Position
17q21.2
AA seq 787 aa AA seqDB search
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttatatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcatgggactcagtagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcagagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgaacagaggttggtc
cgagaagccaacaatggtagctctccagctggaagccttgctgatgccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacgcaggacacagagaat
gagttaaaaaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttggcccgctggcccagctgagcccccaggagcgtctgagccgg
gagacggccctccagcagaagcaggtgtctctggaggcctggttgcagcgtgaggcacag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccccggcccagtggaggagatgctggccgaggtcaacgccaccatc
acggacattatctcagccctggtgaccagcacgttcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccactgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagtggcgagatcttgaacaactgc
tgcgtcatggagtaccaccaagccacaggcacccttagtgcccacttcaggaatatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggggcagagtcggtgacagaagaaaaattt
acaatcctgtttgaatcccagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgatcgttcatggcagccaggacaacaatgcgacggcc
actgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaacctcgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagtggcctgtctgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcaatggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctcctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtccctagccgaccgcttg
ggagacttgaattaccttatctacgtgtttcctgatcggccaaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagctgttgatggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacgcatctgcagatgccgggggc
ggcagcgccacgtacatggaccaggccccctccccagctgtgtgtccccaggctcactat
aacatgtacccacagaaccctgactcagtccttgacaccgatggggacttcgatctggag
gacacaatggacgtagcgcggcgtgtggaggagctcctgggccggccaatggacagtcag
tggatcccgcacgcacaatcgtga

KEGG   Homo sapiens (human): 6778Help
Entry
6778              CDS       T01001                                 

Gene name
STAT6, D12S1644, IL-4-STAT, STAT6B, STAT6C
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    6778 (STAT6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6778 (STAT6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    6778 (STAT6)
   04659 Th17 cell differentiation
    6778 (STAT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6778 (STAT6)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    6778 (STAT6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    6778 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6778 (STAT6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6778 (STAT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 6778
NCBI-ProteinID: NP_001171549
OMIM: 601512
HGNC: 11368
Ensembl: ENSG00000166888
Vega: OTTHUMG00000171194
Pharos: P42226(Tchem)
UniProt: P42226
LinkDB All DBs
Structure
PDB: 

Position
12q13.3
AA seq 847 aa AA seqDB search
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
LRANPSW
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggtctggtctccaagatgcccccagaaaaagtgcagcggctctatgtc
gactttccccaacacctgcggcatcttctgggtgactggctggagagccagccctgggag
ttcctggtcggctccgacgccttctgctgcaacttggctagtgccctactttcagacact
gtccagcaccttcaggcctcggtgggagagcagggggaggggagcaccatcttgcaacac
atcagcacccttgagagcatatatcagagggaccccctgaagctggtggccactttcaga
caaatacttcaaggagagaaaaaagctgttatggaacagttccgccacttgccaatgcct
ttccactggaagcaggaagaactcaagtttaagacaggcttgcggaggctgcagcaccga
gtaggggagatccaccttctccgagaagccctgcagaagggggctgaggctggccaagtg
tctctgcacagcttgatagaaactcctgctaatgggactgggccaagtgaggccctggcc
atgctactgcaggagaccactggagagctagaggcagccaaagccctagtgctgaagagg
atccagatttggaaacggcagcagcagctggcagggaatggcgcaccgtttgaggagagc
ctggccccactccaggagaggtgtgaaagcctggtggacatttattcccagctacagcag
gaggtaggggcggctggtggggagcttgagcccaagacccgggcatcgctgactggccgg
ctggatgaagtcctgagaaccctcgtcaccagttgcttcctggtggagaagcagcccccc
caggtactgaagactcagaccaagttccaggctggagttcgattcctgttgggcttgagg
ttcctgggggccccagccaagcctccgctggtcagggccgacatggtgacagagaagcag
gcgcgggagctgagtgtgcctcagggtcctggggctggagcagaaagcactggagaaatc
atcaacaacactgtgcccttggagaacagcattcctgggaactgctgctctgccctgttc
aagaacctgcttctcaagaagatcaagcggtgtgagcggaagggcactgagtctgtcaca
gaggagaagtgcgctgtgctcttctctgccagcttcacacttggccccggcaaactcccc
atccagctccaggccctgtctctgcccctggtggtcatcgtccatggcaaccaagacaac
aatgccaaagccactatcctgtgggacaatgccttctctgagatggaccgcgtgcccttt
gtggtggctgagcgggtgccctgggagaagatgtgtgaaactctgaacctgaagttcatg
gctgaggtggggaccaaccgggggctgctcccagagcacttcctcttcctggcccagaag
atcttcaatgacaacagcctcagtatggaggccttccagcaccgttctgtgtcctggtcg
cagttcaacaaggagatcctgctgggccgtggcttcaccttttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtctgaccggctgatcattggc
ttcatcagcaaacagtacgttactagccttcttctcaatgagcccgacggaacctttctc
ctccgcttcagcgactcagagattgggggcatcaccattgcccatgtcatccggggccag
gatggctctccacagatagagaacatccagccattctctgccaaagacctgtccattcgc
tcactgggggaccgaatccgggatcttgctcagctcaaaaatctctatcccaagaagccc
aaggatgaggctttccggagccactacaagcctgaacagatgggtaaggatggcaggggt
tatgtcccagctaccatcaagatgaccgtggaaagggaccaaccacttcctaccccagag
ctccagatgcctaccatggtgccttcttatgaccttggaatggcccctgattcctccatg
agcatgcagcttggcccagatatggtgccccaggtgtacccaccacactctcactccatc
cccccgtatcaaggcctctccccagaagaatcagtcaacgtgttgtcagccttccaggag
cctcacctgcagatgccccccagcctgggccagatgagcctgccctttgaccagcctcac
ccccagggcctgctgccgtgccagcctcaggagcatgctgtgtccagccctgaccccctg
ctctgctcagatgtgaccatggtggaagacagctgcctgagccagccagtgacagcgttt
cctcagggcacttggattggtgaagacatattccctcctctgctgcctcccactgaacag
gacctcactaagcttctcctggaggggcaaggggagtcggggggagggtccttgggggca
cagcccctcctgcagccctcccactatgggcaatctgggatctcaatgtcccacatggac
ctaagggccaaccccagttggtga

DBGET integrated database retrieval system