KEGG   Homo sapiens (human): 200959
Entry
200959            CDS       T01001                                 
Symbol
GABRR3
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit rho3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    200959 (GABRR3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    200959 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    200959 (GABRR3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    200959 (GABRR3)
   05033 Nicotine addiction
    200959 (GABRR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    200959 (GABRR3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   200959 (GABRR3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 200959
NCBI-ProteinID: NP_001099050
OMIM: 618668
HGNC: 17969
Ensembl: ENSG00000183185
Pharos: A8MPY1(Tdark)
UniProt: A8MPY1
LinkDB
Position
3:complement(97985102..98035315)
AA seq 467 aa
MVLAFQLVSFTYIWIILKPNVCAASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQK
YEQLLHIEDNDFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLS
FPSTANKSMTFDHRLTRKIWVPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITV
SAMCFMDFSRFPLDTQNCSLELESYAYNEDDLMLYWKHGNKSLNTEEHMSLSQFFIEDFS
ASSGLAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARV
SLGITTVLTMSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEER
KQFKKTGKISRMYNIDAVQAMAFDGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSS
RIKRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFNLFYWGVYV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtcctggctttccagttagtctccttcacctacatctggatcatattgaaaccaaat
gtttgtgctgcttctaacatcaagatgacacaccagcggtgctcctcttcaatgaaacaa
acctgcaaacaagaaactagaatgaagaaagatgacagtaccaaagcgcggcctcagaaa
tatgagcaacttctccatatagaggacaacgatttcgcaatgagacctggatttggaggg
tctccagtgccagtaggtatagatgtccatgttgaaagcattgacagcatttcagagact
aacatggactttacaatgactttttatctcaggcattactggaaagacgagaggctctcc
tttcctagcacagcaaacaaaagcatgacatttgatcatagattgaccagaaagatctgg
gtgcctgatatcttttttgtccactctaaaagatccttcatccatgatacaactatggag
aatatcatgctgcgcgtacaccctgatggaaacgtcctcctaagtctcaggataacggtt
tcggccatgtgctttatggatttcagcaggtttcctcttgacactcaaaattgttctctt
gaactggaaagctatgcctacaatgaggatgacctaatgctatactggaaacacggaaac
aagtccttaaatactgaagaacatatgtccctttctcagttcttcattgaagacttcagt
gcatctagtggattagctttctatagcagcacaggttggtacaataggcttttcatcaac
tttgtgctaaggaggcatgttttcttctttgtgctgcaaacctatttcccagccatattg
atggtgatgctttcatgggtttcattttggattgaccgaagagctgttcctgcaagagtt
tccctgggaatcaccacagtgctgaccatgtccacaatcatcactgctgtgagcgcctcc
atgccccaggtgtcctacctcaaggctgtggatgtgtacctgtgggtcagctccctcttt
gtgttcctgtcagtcattgagtatgcagctgtgaactacctcaccacagtggaagagcgg
aaacaattcaagaagacaggaaagatttctaggatgtacaatattgatgcagttcaagct
atggcctttgatggttgttaccatgacagcgagattgacatggaccagacttccctctct
ctaaactcagaagacttcatgagaagaaaatcgatatgcagccccagcaccgattcatct
cggataaagagaagaaaatccctaggaggacatgttggtagaatcattctggaaaacaac
catgtcattgacacctattctaggattttattccccattgtgtatattttatttaatttg
ttttactggggtgtatatgtatga

KEGG   Homo sapiens (human): 2554
Entry
2554              CDS       T01001                                 
Symbol
GABRA1, DEE19, ECA4, EIEE19, EJM, EJM5
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
H00808  Idiopathic generalized epilepsies
H02215  Childhood absence epilepsy
H02217  Juvenile myoclonic epilepsy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clomethiazole (DG00923): D07330 D07725
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Etomidate: D00548<US>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methohexital (DG00789): D00712<US> D04985
Methylphenobarbital: D00700
Methyprylon: D01150
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Progabide: D05621
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zaleplon: D00530<US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2554 (GABRA1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2554 (GABRA1)
   04723 Retrograde endocannabinoid signaling
    2554 (GABRA1)
  09157 Sensory system
   04742 Taste transduction
    2554 (GABRA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2554 (GABRA1)
   05033 Nicotine addiction
    2554 (GABRA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2554 (GABRA1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2554 (GABRA1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2554
NCBI-ProteinID: NP_000797
OMIM: 137160
HGNC: 4075
Ensembl: ENSG00000022355
Pharos: P14867(Tclin)
UniProt: P14867 A8K177
Structure
LinkDB
Position
5:161847191..161899971
AA seq 456 aa
MRKSPGLSDCLWAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaggaaaagtccaggtctgtctgactgtctttgggcctggatcctccttctgagcaca
ctgactggaagaagctatggacagccgtcattacaagatgaacttaaagacaataccact
gtcttcaccaggattttggacagactcctagatggttatgacaatcgcctgagaccagga
ttgggagagcgtgtaaccgaagtgaagactgatatcttcgtcaccagtttcggacccgtt
tcagaccatgatatggaatatacaatagatgtatttttccgtcaaagctggaaggatgaa
aggttaaaatttaaaggacctatgacagtcctccggttaaataacctaatggcaagtaaa
atctggactccggacacatttttccacaatggaaagaagtcagtggcccacaacatgacc
atgcccaacaaactcctgcggatcacagaggatggcaccttgctgtacaccatgaggctg
acagtgagagctgaatgtccgatgcatttggaggacttccctatggatgcccatgcttgc
ccactaaaatttggaagttatgcttatacaagagcagaagttgtttatgaatggaccaga
gagccagcacgctcagtggttgtagcagaagatggatcacgtctaaaccagtatgacctt
cttggacaaacagtagactctggaattgtccagtcaagtacaggagaatatgttgttatg
accactcatttccacttgaagagaaagattggctactttgttattcaaacatacctgcca
tgcataatgacagtgattctctcacaagtctccttctggctcaacagagagtctgtacca
gcaagaactgtctttggagtaacaactgtgctcaccatgacaacattgagcatcagtgcc
agaaactccctccctaaggtggcttatgcaacagctatggattggtttattgccgtgtgc
tatgcctttgtgttctcagctctgattgagtttgccacagtaaactatttcactaagaga
ggttatgcatgggatggcaaaagtgtggttccagaaaagccaaagaaagtaaaggatcct
cttattaagaaaaacaacacttacgctccaacagcaaccagctacacccctaatttggcc
aggggcgacccgggcttagccaccattgctaaaagtgcaaccatagaacctaaagaggtc
aagcccgaaacaaaaccaccagaacccaagaaaacctttaacagtgtcagcaaaattgac
cgactgtcaagaatagccttcccgctgctatttggaatctttaacttagtctactgggct
acgtatttaaacagagagcctcagctaaaagcccccacaccacatcaatag

KEGG   Homo sapiens (human): 2555
Entry
2555              CDS       T01001                                 
Symbol
GABRA2, DEE78, EIEE78
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha2
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
H01611  Alcohol dependence
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2555 (GABRA2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2555 (GABRA2)
   04723 Retrograde endocannabinoid signaling
    2555 (GABRA2)
  09157 Sensory system
   04742 Taste transduction
    2555 (GABRA2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2555 (GABRA2)
   05033 Nicotine addiction
    2555 (GABRA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2555 (GABRA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2555 (GABRA2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Other DBs
NCBI-GeneID: 2555
NCBI-ProteinID: NP_000798
OMIM: 137140
HGNC: 4076
Ensembl: ENSG00000151834
Pharos: P47869(Tclin)
UniProt: P47869 A0A024R9X6
LinkDB
Position
4:complement(46243548..46390300)
AA seq 451 aa
MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgaagacaaaattgaacatctacaacatgcagttcctgctttttgttttcttggtgtgg
gaccctgccaggttggtgctggctaacatccaagaagatgaggctaaaaataacattacc
atctttacgagaattcttgacagacttctggatggttacgataatcggcttagaccagga
ctgggagacagtattactgaagtcttcactaacatctacgtgaccagttttggccctgtc
tcagatacagatatggaatatacaattgatgttttctttcgacaaaaatggaaagatgaa
cgtttaaaatttaaaggtcctatgaatatccttcgactaaacaatttaatggctagcaaa
atctggactccagataccttttttcacaatgggaaaaaatcagtagctcataatatgaca
atgccaaataagttgcttcgaattcaggatgatgggactctgctgtataccatgaggctt
acagttcaagctgaatgcccaatgcacttggaggatttcccaatggatgctcattcatgt
cctctgaaatttggcagctatgcatatacaacttcagaggtcacttatatttggacttac
aatgcatctgattcagtacaggttgctcctgatggctctaggttaaatcaatatgacctg
ctgggccaatcaatcggaaaggagacaattaaatccagtacaggtgaatatactgtaatg
acagctcatttccacctgaaaagaaaaattgggtattttgtgattcaaacctatctgcct
tgcatcatgactgtcattctctcccaagtttcattctggcttaacagagaatctgtgcct
gcaagaactgtgtttggagtaacaactgtcctaacaatgacaactctaagcatcagtgct
cggaattctctccccaaagtggcttatgcaactgccatggactggtttattgctgtttgt
tatgcatttgtgttctctgccctaattgaatttgcaactgttaattacttcaccaaaaga
ggatgggcttgggatgggaagagtgtagtaaatgacaagaaaaaagaaaaggcttccgtt
atgatacagaacaacgcttatgcagtggctgttgccaattatgccccgaatctttcaaaa
gatccagttctctccaccatctccaagagtgcaaccacgccagaacccaacaagaagcca
gaaaacaagccagctgaagcaaagaaaactttcaacagtgttagcaaaattgacagaatg
tccagaatagtttttccagttttgtttggtacctttaatttagtttactgggctacatat
ttaaacagagaacctgtattaggggtcagtccttga

KEGG   Homo sapiens (human): 2556
Entry
2556              CDS       T01001                                 
Symbol
GABRA3
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha3
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2556 (GABRA3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2556 (GABRA3)
   04723 Retrograde endocannabinoid signaling
    2556 (GABRA3)
  09157 Sensory system
   04742 Taste transduction
    2556 (GABRA3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2556 (GABRA3)
   05033 Nicotine addiction
    2556 (GABRA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2556 (GABRA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2556 (GABRA3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2556
NCBI-ProteinID: NP_000799
OMIM: 305660
HGNC: 4077
Ensembl: ENSG00000011677
Pharos: P34903(Tclin)
UniProt: P34903
LinkDB
Position
X:complement(152166234..152451315)
AA seq 492 aa
MIITQTSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPAKKTSTTFNIVGTTYPINLAKDTEFSTISKGA
APSASSTPTIIASPKATYVQDSPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgataatcacacaaacaagtcactgttacatgaccagccttgggattcttttcctgatt
aatattctccctggaaccactggtcaaggggaatcaagacgacaagaacccggggacttt
gtgaagcaggacattggcgggctgtctcctaagcatgccccagatattcctgatgacagc
actgacaacatcactatcttcaccagaatcttggatcgtcttctggacggctatgacaac
cggctgcgacctgggcttggagatgcagtgactgaagtgaagactgacatctacgtgacc
agttttggccctgtgtcagacactgacatggagtacactattgatgtattttttcggcag
acatggcatgatgaaagactgaaatttgatggccccatgaagatccttccactgaacaat
ctcctggctagtaagatctggacaccggacaccttcttccacaatggcaagaaatcagtg
gctcataacatgaccacgcccaacaagctgctcagattggtggacaacggaaccctcctc
tatacaatgaggttaacaattcatgctgagtgtcccatgcatttggaagattttcccatg
gatgtgcatgcctgcccactgaagtttggaagctatgcctatacaacagctgaagtggtt
tattcttggactctcggaaagaacaaatccgtggaagtggcacaggatggttctcgcttg
aaccagtatgaccttttgggccatgttgttgggacagagataatccggtctagtacagga
gaatatgtcgtcatgacaacccacttccatctcaagcgaaaaattggctactttgtgatc
cagacctacttgccatgtatcatgactgtcattctgtcacaagtgtcgttctggctcaac
agagagtctgttcctgcccgtacagtctttggtgtcaccactgtgcttaccatgaccacc
ttgagtatcagtgccagaaattccttacctaaagtggcatatgcgacggccatggactgg
ttcatagccgtctgttatgcctttgtattttctgcactgattgaatttgccactgtcaac
tatttcaccaagcggagttgggcttgggaaggcaagaaggtgccagaggccctggagatg
aagaagaaaacaccagcagccccagcaaagaaaaccagcactaccttcaacatcgtgggg
accacctatcccatcaacctggccaaggacactgaattttccaccatctccaagggcgct
gctcccagtgcctcctcaaccccaacaatcattgcttcacccaaggccacctacgtgcag
gacagcccgactgagaccaagacctacaacagtgtcagcaaggttgacaaaatttcccgc
atcatctttcctgtgctctttgccatattcaatctggtctattgggccacatatgtcaac
cgggagtcagctatcaagggcatgatccgcaaacagtag

KEGG   Homo sapiens (human): 2557
Entry
2557              CDS       T01001                                 
Symbol
GABRA4
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha4
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2557 (GABRA4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2557 (GABRA4)
   04723 Retrograde endocannabinoid signaling
    2557 (GABRA4)
  09157 Sensory system
   04742 Taste transduction
    2557 (GABRA4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2557 (GABRA4)
   05033 Nicotine addiction
    2557 (GABRA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2557 (GABRA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2557 (GABRA4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 2557
NCBI-ProteinID: NP_000800
OMIM: 137141
HGNC: 4078
Ensembl: ENSG00000109158
Pharos: P48169(Tclin)
UniProt: P48169 X5D7F5
Structure
LinkDB
Position
4:complement(46918900..46993581)
AA seq 554 aa
MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMEKAKRKTSKPPQ
EVPAAPVQREKHPEAPLQNTNANLNMRKRTNALVHSESDVGNRTEVGNHSSKSSTVVQES
SKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFG
SRLQRIKTTVNTIGATGKLSATPPPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVV
YLSKDTMEKSESLM
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtttctgccaagaaggtacccgcgatcgctctgtccgccggggtcagtttcgccctc
ctgcgcttcctgtgcctggcggtttgtttaaacgaatccccaggacagaaccaaaaggag
gagaaattgtgcacagaaaatttcacccgcatcctggacagtttgctcgatggttatgac
aacaggctgcgtcctggatttgggggtcctgttacagaagtgaaaactgacatatatgtc
accagctttggacctgtttctgatgttgaaatggaatacacaatggatgtgttcttcagg
cagacatggattgacaaaagattaaaatatgacggccccattgaaattttgagattgaac
aatatgatggtaacgaaagtgtggacccctgatactttcttcaggaatggaaagaaatct
gtctcacataatatgacagctccaaataagctttttagaattatgagaaatggtactatt
ttatacacaatgagactcaccataagtgcggagtgtcccatgagattggtggattttccc
atggatggtcatgcatgccctttgaaattcgggagttatgcctatccaaagagtgagatg
atctatacctggacaaaaggtcctgagaaatcagttgaagttccgaaggagtcttccagc
ttagttcaatatgatttgattgggcaaaccgtatcaagtgaaaccatcaaatcaattacg
ggtgaatatattgttatgacggtttacttccacctcagacggaagatgggttattttatg
attcagacctatattccgtgcattatgacagtgattctttctcaagtttcattttggata
aataaagaatcagttcccgctaggactgtatttggaataacaactgtcctcaccatgacc
acactaagcatcagtgcacgacattctttgcccaaagtgtcctatgctaccgccatggac
tggttcatagctgtctgctttgcttttgtattttcggcccttatcgagtttgctgctgtc
aactatttcaccaatattcaaatggaaaaagccaaaaggaagacatcaaagccccctcag
gaagttcccgctgctccagtgcagagagagaagcatcctgaagcccctctgcagaataca
aatgccaatttgaacatgagaaaaagaacaaatgctttggttcactctgaatctgatgtt
ggcaacagaactgaggtgggaaaccattcaagcaaatcttccacagttgttcaagaatct
tctaaaggcacacctcggtcttacttagcttccagtccaaacccattcagccgtgcaaat
gcagctgaaaccatatctgcagcaagagcacttccatctgcttctcctacttctatccga
actggatatatgcctcgaaaggcttcagttggatctgcttctactcgtcacgtgtttgga
tcaagactgcagaggataaagaccacagttaataccataggggctactgggaagttgtca
gctactcctcctccatcggctccaccaccttctggatctggcacaagtaaaatagacaaa
tatgcccgtattctctttccagtcacatttggggcatttaacatggtttattgggttgtt
tatttatctaaggacactatggagaaatcagaaagtctaatgtaa

KEGG   Homo sapiens (human): 2558
Entry
2558              CDS       T01001                                 
Symbol
GABRA5, DEE79, EIEE79
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha5
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alogabat: D12382
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2558 (GABRA5)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2558 (GABRA5)
   04723 Retrograde endocannabinoid signaling
    2558 (GABRA5)
  09157 Sensory system
   04742 Taste transduction
    2558 (GABRA5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2558 (GABRA5)
   05033 Nicotine addiction
    2558 (GABRA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2558 (GABRA5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2558 (GABRA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Other DBs
NCBI-GeneID: 2558
NCBI-ProteinID: NP_000801
OMIM: 137142
HGNC: 4079
Ensembl: ENSG00000186297
Pharos: P31644(Tclin)
UniProt: P31644
Structure
LinkDB
Position
15:26866719..26949208
AA seq 462 aa
MDNGMFSGFIMIKNLLLFCISMNLSSHFGFSQMPTSSVKDETNDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYN
SISKIDKMSRIVFPVLFGTFNLVYWATYLNREPVIKGAASPK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggacaatggaatgttctctggttttatcatgatcaaaaacctccttctcttttgtatt
tccatgaacttatccagtcactttggcttttcacagatgccaaccagttcagtgaaagat
gagaccaatgacaacatcacgatatttaccaggatcttggatgggctcttggatggctac
gacaacagacttcggcccgggctgggagagcgcatcactcaggtgaggaccgacatctac
gtcaccagcttcggcccggtgtccgacacggaaatggagtacaccatagacgtgtttttc
cgacaaagctggaaagatgaaaggcttcggtttaaggggcccatgcagcgcctccctctc
aacaacctccttgccagcaagatctggaccccagacacgttcttccacaacgggaagaag
tccatcgctcacaacatgaccacgcccaacaagctgctgcggctggaggacgacggcacc
ctgctctacaccatgcgcttgaccatctctgcagagtgccccatgcagcttgaggacttc
ccgatggatgcgcacgcttgccctctgaaatttggcagctatgcgtaccctaattctgaa
gtcgtttacgtctggaccaacggctccaccaagtcggtggtggtggcggaagatggctcc
agactgaaccagtaccacctgatggggcagacggtgggcactgagaacatcagcaccagc
acaggcgaatacacaatcatgacagctcacttccacctgaaaaggaagattggctacttt
gtcatccagacctaccttccctgcataatgaccgtgatcttatcacaggtgtccttttgg
ctgaaccgggaatcagtcccagccaggacagtttttggggtcaccacggtgctgaccatg
acgaccctcagcatcagcgccaggaactctctgcccaaagtggcctacgccaccgccatg
gactggttcatagccgtgtgctatgccttcgtcttctcggcgctgatagagtttgccacg
gtcaattactttaccaagagaggctgggcctgggatggcaaaaaagccttggaagcagcc
aagatcaagaaaaagcgtgaagtcatactaaataagtcaacaaacgcttttacaactggg
aagatgtctcaccccccaaacattccgaaggaacagaccccagcagggacgtcgaataca
acctcagtctcagtaaaaccctctgaagagaagacttctgaaagcaaaaagacttacaac
agtatcagcaaaattgacaaaatgtcccgaatcgtattcccagtcttgttcggcactttc
aacttagtttactgggcaacgtatttgaatagggagccggtgataaaaggagccgcctct
ccaaaataa

KEGG   Homo sapiens (human): 2559
Entry
2559              CDS       T01001                                 
Symbol
GABRA6
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit alpha6
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa04742  Taste transduction
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2559 (GABRA6)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2559 (GABRA6)
   04723 Retrograde endocannabinoid signaling
    2559 (GABRA6)
  09157 Sensory system
   04742 Taste transduction
    2559 (GABRA6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2559 (GABRA6)
   05033 Nicotine addiction
    2559 (GABRA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2559 (GABRA6)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2559 (GABRA6)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF4396
Other DBs
NCBI-GeneID: 2559
NCBI-ProteinID: NP_000802
OMIM: 137143
HGNC: 4080
Ensembl: ENSG00000145863
Pharos: Q16445(Tclin)
UniProt: Q16445
LinkDB
Position
5:161685721..161702592
AA seq 453 aa
MASSLPWLCIILWLENALGKLEVEGNFYSENVSRILDNLLEGYDNRLRPGFGGAVTEVKT
DIYVTSFGPVSDVEMEYTMDVFFRQTWTDERLKFGGPTEILSLNNLMVSKIWTPDTFFRN
GKKSIAHNMTTPNKLFRIMQNGTILYTMRLTINADCPMRLVNFPMDGHACPLKFGSYAYP
KSEIIYTWKKGPLYSVEVPEESSSLLQYDLIGQTVSSETIKSNTGEYVIMTVYFHLQRKM
GYFMIQIYTPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYA
TAMDWFIAVCFAFVFSALIEFAAVNYFTNLQTQKAKRKAQFAAPPTVTISKATEPLEAEI
VLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQY
SRILFPVAFAGFNLVYWVVYLSKDTMEVSSSVE
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcgtcgtctctgccctggctgtgcattattctgtggctagaaaatgccctagggaaa
ctcgaagttgaaggcaacttctactcagaaaacgtcagtcggatcctggacaacttgctt
gaaggctatgacaatcggctgcggccgggatttggaggtgctgtcactgaagtcaaaaca
gacatttatgtgaccagttttgggcccgtgtcagatgtggagatggagtatacgatggat
gtttttttccgccagacctggactgatgagaggttgaagtttggggggccaactgagatt
ctgagtctgaataatttgatggtcagtaaaatctggacgcctgacacctttttcagaaat
ggtaaaaagtccattgctcacaacatgacaactcctaataaactcttcagaataatgcag
aatggaaccattttatacaccatgaggcttaccatcaatgctgactgtcccatgaggctg
gttaactttcctatggatgggcatgcttgtccactcaagtttgggagctatgcttatccc
aaaagtgaaatcatatatacgtggaaaaaaggaccactttactcagtagaagtcccagaa
gaatcttcaagccttctccagtatgatctgattggacaaacagtatctagtgagacaatt
aaatctaacacaggtgaatacgttataatgacagtttacttccacttgcaaaggaagatg
ggctacttcatgatacagatatacactccttgcattatgacagtcattctttcccaggtg
tctttctggattaataaggagtccgtcccagcaagaactgtttttgggatcaccactgtt
ttaactatgaccactttgagcatcagtgcccggcactctttgccaaaagtgtcatatgcc
actgccatggattggttcatagctgtttgctttgcattcgtcttctctgcgcttatcgag
ttcgcagctgtcaactactttaccaatcttcagacacagaaggccaaaaggaaggcacag
tttgcagccccacccacagtgacaatatcaaaagctactgaacctttggaagctgagatt
gttttgcatcctgactccaaatatcatctgaagaaaaggatcacttctctgtctttgcca
atagtttcatcttccgaggccaataaagtgctcacgagagcgcccatcttacaatcaaca
cctgtcacacccccaccactctcgccagcctttggaggcaccagtaaaatagaccagtat
tctcgaattctcttcccagttgcatttgcaggattcaaccttgtgtactgggtagtttat
ctttccaaagatacaatggaagtcagtagcagtgttgaatag

KEGG   Homo sapiens (human): 2560
Entry
2560              CDS       T01001                                 
Symbol
GABRB1, DEE45, EIEE45
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit beta1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2560 (GABRB1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2560 (GABRB1)
   04726 Serotonergic synapse
    2560 (GABRB1)
   04723 Retrograde endocannabinoid signaling
    2560 (GABRB1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2560 (GABRB1)
   05033 Nicotine addiction
    2560 (GABRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2560 (GABRB1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2560 (GABRB1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 2560
NCBI-ProteinID: NP_000803
OMIM: 137190
HGNC: 4081
Ensembl: ENSG00000163288
Pharos: P18505(Tclin)
UniProt: P18505 X5DNL6
LinkDB
Position
4:46993647..47426447
AA seq 474 aa
MWTVQNRESLGLLSFPVMITMVCCAHSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDR
HGVPSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtggacagtacaaaatcgagagagtctggggcttctctctttccctgtgatgattacc
atggtctgttgtgcacacagcaccaatgaacccagcaacatgtcatacgtgaaagagaca
gtggacagattgctcaaaggatatgacattcgcttgcggccggacttcggagggcccccc
gtcgacgttgggatgcggatcgatgtcgccagcatagacatggtctccgaagtgaatatg
gattatacactcaccatgtatttccagcagtcttggaaagacaaaaggctttcttattct
ggaatcccactgaacctcaccctagacaatagggtagctgaccaactctgggtaccagac
acctactttctgaatgacaagaaatcatttgtgcatggggtcacagtgaaaaatcgaatg
attcgactgcatcctgatggaacagttctctatggactccgaatcacaaccacagctgca
tgtatgatggatcttcgaagatatccattggatgagcagaactgcaccctggagatcgaa
agttatggctataccactgatgacattgaattttactggaatggaggagaaggggcagtc
actggtgttaataaaatcgaacttcctcaattttcaattgttgactacaagatggtgtct
aagaaggtggagttcacaacaggagcgtatccacgactgtcactaagttttcgtctaaag
agaaacattggttacttcattttgcaaacctacatgccttctacactgattacaattctg
tcctgggtgtctttttggatcaactatgatgcatctgcagccagagtcgcactaggaatc
acgacagtgcttacaatgacaaccatcagcacccacctcagggagaccctgccaaagatc
ccttatgtcaaagcgattgatatttatctgatgggttgctttgtgtttgtgttcctggct
ctgctggagtatgcctttgtaaattacatcttctttgggaaaggccctcagaaaaaggga
gctagcaaacaagaccagagtgccaatgagaagaataaactggagatgaataaagtccag
gtcgacgcccacggtaacattctcctcagcaccctggaaatccggaatgagacgagtggc
tcggaagtgctcacgagcgtgagcgaccccaaggccaccatgtactcctatgacagcgcc
agcatccagtaccgcaagcccctgagcagccgcgaggcctacgggcgcgccctggaccgg
cacggggtacccagcaaggggcgcatccgcaggcgtgcctcccagctcaaagtcaagatc
cccgacttgactgatgtgaattccatagacaagtggtcccgaatgtttttccccatcacc
ttttctctttttaatgtcgtctattggctttactatgtacactga

KEGG   Homo sapiens (human): 2561
Entry
2561              CDS       T01001                                 
Symbol
GABRB2, DEE92, ICEE2
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit beta2
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
H02150  Infantile or early childhood epileptic encephalopathy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2561 (GABRB2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2561 (GABRB2)
   04726 Serotonergic synapse
    2561 (GABRB2)
   04723 Retrograde endocannabinoid signaling
    2561 (GABRB2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2561 (GABRB2)
   05033 Nicotine addiction
    2561 (GABRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2561 (GABRB2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2561 (GABRB2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2561
NCBI-ProteinID: NP_068711
OMIM: 600232
HGNC: 4082
Ensembl: ENSG00000145864
Pharos: P47870(Tclin)
UniProt: P47870
Structure
LinkDB
Position
5:complement(161288436..161548404)
AA seq 512 aa
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKI
FYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD
LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtggagagtgcggaaaaggggctactttgggatttggtccttccccttaataatcgcc
gctgtctgtgcgcagagtgtcaatgaccctagtaatatgtcgctggttaaagagacggtg
gatagactcctgaaaggctatgacattcgtctgagaccagattttggaggtccccccgtg
gctgtggggatgaacattgacattgccagcatcgatatggtttctgaagtcaatatggat
tataccttgacaatgtactttcaacaagcctggagagataagaggctgtcctataatgta
atacctttaaacttgactctggacaacagagtggcagaccagctctgggtgcctgatacc
tatttcctgaacgataagaagtcatttgtgcacggagtgactgttaagaaccgcatgatt
cgcctgcatcctgatggcaccgtcctttatggactcagaatcacaaccacagctgcctgc
atgatggacctaaggaggtacccactggatgaacaaaactgcaccttggaaattgagagc
tatggatacacaactgatgacattgagttttactggcgtggcgatgataatgcagtaaca
ggagtaacgaaaattgaacttccacagttctctattgtagattacaaacttatcaccaag
aaggttgttttttccacaggttcctatcccaggttatccctcagctttaagcttaagaga
aacattggctactttatcctgcaaacatacatgccttccatcctgattaccatcctctcc
tgggtctccttctggattaattacgatgcttcagctgcaagggtggcattaggaatcaca
actgtcctcacaatgaccacaatcaacacccacctccgggaaactctccctaaaatcccc
tatgtgaaggccattgacatgtacctgatggggtgctttgtcttcgttttcatggccctt
ctggaatatgccctagtcaactacatcttctttgggagggggccccaacgccaaaagaaa
gcagctgagaaggctgccagtgccaacaatgagaagatgcgcctggatgtcaacaagatt
ttttataaagatattaaacaaaatgggacccaatatcgatccttgtgggaccctactgga
aacctctccccaactagacggactaccaattacgatttctctctgtatacgatggacccc
catgagaacatcttactgagcactctcgagataaaaaatgaaatggccacatctgaggct
gtgatgggacttggagaccccagaagcacaatgctagcctatgatgcctccagcatccag
tatcggaaagctgggttgcccaggcatagttttggccgaaatgctctggaacgacatgtg
gcgcaaaagaaaagtcgcctgaggagacgcgcctcccaactgaaaatcaccatccctgac
ttgactgatgtgaatgccatagatcggtggtcccgcatattcttcccagtggttttttcc
ttcttcaacatcgtctattggctttattatgtgaactaa

KEGG   Homo sapiens (human): 2562
Entry
2562              CDS       T01001                                 
Symbol
GABRB3, DEE43, ECA5, EIEE43
Name
(RefSeq) gamma-aminobutyric acid type A receptor subunit beta3
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Disease
H00606  Early infantile epileptic encephalopathy
H02215  Childhood absence epilepsy
Drug target
Abecarnil: D02594
Adinazolam (DG00911): D02770 D02771
Adipiplon: D08840
Alpidem: D02833
Alprazolam: D00225<JP/US>
Aminobutyric acid: D00058<JP>
Amobarbital (DG00916): D00555<JP> D02252
Aprobarbital: D00698
Barbexaclone: D07298
Barbital: D01740
Bretazenil: D03155
Brexanolone: D11149<US>
Bromazepam: D01245<JP>
Brotizolam: D01744<JP>
Butabarbital (DG01308): D00699 D03180
Butobarbital: D02618
Cenobamate: D11150<US>
Chlordiazepoxide (DG00908): D00267<JP> D00693<US>
Cinolazepam: D07328
Cipepofol: D12449
Clobazam: D01253<JP/US>
Clonazepam: D00280<JP/US>
Clotiazepam: D01328<JP>
Cloxazolam: D01268<JP>
Darigabat: D12146
Delorazepam: D07784
Dextofisopam: D03737
Diazepam: D00293<JP/US>
Estazolam: D00311<JP/US>
Eszopiclone: D02624<JP/US>
Ethyl loflazepate: D01293<JP>
Etizolam: D01514<JP>
Fludiazepam: D01354<JP>
Flumazenil: D00697<JP/US>
Flunitrazepam: D01230<JP>
Flurazepam (DG00919): D00329 D00695<US> D01408<JP>
Flutazolam: D01286<JP>
Flutoprazepam: D01279<JP>
Gaboxadol: D04282
Ganaxolone: D04300<US>
Glutethimide: D00532
Halazepam: D00338
Haloxazolam: D01758<JP>
Hexobarbital: D01071
Indiplon: D02640
Iomazenil: D02283<JP>
Ketazolam: D04650
Levotofisopam: D04721
Loprazolam (DG00921): D07326 D08145
Lorazepam: D00365<JP/US>
Lormetazepam: D01657<JP>
Medazepam (DG00909): D01292<JP> D04882
Meprobamate: D00376<US>
Metharbital: D01382
Methylphenobarbital: D00700
Mexazolam: D01316<JP>
Midazolam (DG00920): D00550<JP/US> D00696<US> D05028
Nimetazepam: D01593
Nitrazepam: D00531<JP>
Nordazepam: D08283
Ocinaplon: D02617
Oxazepam: D00464<US>
Oxazolam: D01278<JP>
Pagoclone: D02616
Panadiplon: D05346
Pazinaclone: D05378
Pentobarbital (DG00915): D00499 D00500<US> D02253<JP>
Phenobarbital (DG00845): D00506<JP> D00701<JP> D08356
Potassium clorazepate (DG01218): D00694<JP/US> D03562
Prazepam: D00470
Propofol (DG00797): D00549<JP/US> D04257
Quazepam: D00457<JP/US>
Remimazolam (DG03105): D10194<JP/US> D11788
Rilmazafone (DG01307): D01564<JP> D08481
Sarmazenil: D08507
Secobarbital (DG00917): D00430 D01310<JP>
Suritozole: D05980
Talbutal: D06887
Temazepam: D00370<US>
Thiamylal (DG01377): D00713<JP> D06106
Thiopental (DG00790): D00714<JP>
Tofisopam: D01254<JP>
Topiramate: D00537<JP/US>
Triazolam: D00387<JP/US>
Zolpidem (DG00922): D00706<JP/US> D08690
Zopiclone: D01372<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2562 (GABRB3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2562 (GABRB3)
   04726 Serotonergic synapse
    2562 (GABRB3)
   04723 Retrograde endocannabinoid signaling
    2562 (GABRB3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2562 (GABRB3)
   05033 Nicotine addiction
    2562 (GABRB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2562 (GABRB3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2562 (GABRB3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 2562
NCBI-ProteinID: NP_000805
OMIM: 137192
HGNC: 4083
Ensembl: ENSG00000166206
Pharos: P28472(Tclin)
UniProt: P28472
Structure
LinkDB
Position
15:complement(26543552..26773763)
AA seq 473 aa
MWGLAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtggggccttgcgggaggaaggcttttcggcatcttctcggccccggtgctggtggct
gtggtgtgctgcgcccagagtgtgaacgatcccgggaacatgtcctttgtgaaggagacg
gtggacaagctgttgaaaggctacgacattcgcctaagacccgacttcgggggtcccccg
gtctgcgtggggatgaacatcgacatcgccagcatcgacatggtttccgaagtcaacatg
gattataccttaaccatgtattttcaacaatattggagagataaaaggctcgcctattct
gggatccctctcaacctcacgcttgacaatcgagtggctgaccagctatgggtgcccgac
acatatttcttaaatgacaaaaagtcatttgtgcatggagtgacagtgaaaaaccgcatg
atccgtcttcaccctgatgggacagtgctgtatgggctcagaatcaccacgacagcagca
tgcatgatggacctcaggagataccccctggacgagcagaactgcactctggaaattgaa
agctatggctacaccacggatgacattgagttttactggcgaggcggggacaaggctgtt
accggagtggaaaggattgagctcccgcagttctccatcgtggagcaccgtctggtctcg
aggaatgttgtcttcgccacaggtgcctatcctcgactgtcactgagctttcggttgaag
aggaacattggatacttcattcttcagacttatatgccctctatactgataacgattctg
tcgtgggtgtccttctggatcaattatgatgcatctgctgctagagttgccctcgggatc
acaactgtgctgacaatgacaaccatcaacacccaccttcgggagaccttgcccaaaatc
ccctatgtcaaagccattgacatgtaccttatgggctgcttcgtctttgtgttcctggcc
cttctggagtatgcctttgtcaactacattttctttggaagaggccctcaaaggcagaag
aagcttgcagaaaagacagccaaggcaaagaatgaccgttcaaagagcgaaagcaaccgg
gtggatgctcatggaaatattctgttgacatcgctggaagttcacaatgaaatgaatgag
gtctcaggcggcattggcgataccaggaattcagcaatatcctttgacaactcaggaatc
cagtacaggaaacagagcatgcctcgagaagggcatgggcgattcctgggggacagaagc
ctcccgcacaagaagacccatctacggaggaggtcttcacagctcaaaattaaaatacct
gatctaaccgatgtgaatgccatagacagatggtccaggatcgtgtttccattcactttt
tctcttttcaacttagtttactggctgtactatgttaactga

DBGET integrated database retrieval system