KEGG   Homo sapiens (human): 1441
Entry
1441              CDS       T01001                                 
Symbol
CSF3R, CD114, GCSFR, SCN7
Name
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06518  JAK-STAT signaling
  Element
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Disease
H00100  Neutropenic disorders
H02410  Myelodysplastic/myeloproliferative neoplasms
H02412  Atypical chronic myeloid leukemia
Drug target
Anumigilimab: D12731
Balugrastim: D10310
Efbemalenograstim alfa: D11986<US>
Eflapegrastim: D11188<US>
Filgrastim: D03235<JP/US>
Lenograstim: D03247<JP>
Leridistim: D04695
Lipegfilgrastim: D10242
Milodistim: D05036
Nartograstim: D03245
Pegfilgrastim: D06889<JP/US>
Pegnartograstim: D05389
Pegteograstim: D11026
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1441 (CSF3R)
   04151 PI3K-Akt signaling pathway
    1441 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1441 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1441 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1441 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1441 (CSF3R)
   04090 CD molecules [BR:hsa04090]
    1441 (CSF3R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   1441 (CSF3R)
CD molecules [BR:hsa04090]
 Proteins
  1441 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 1441
NCBI-ProteinID: NP_000751
OMIM: 138971
HGNC: 2439
Ensembl: ENSG00000119535
UniProt: Q99062
Structure
LinkDB
Position
1:complement(36466043..36483314)
AA seq 836 aa
MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG
YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRME
QNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHIILGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP
SVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGL
PTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgggaaactgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacccggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggacccaggaatctatcatcaccctgccccacctcaaccacactcaggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagccataccccacaacctctcctgcctcatgaacctcacaaccagcagcctc
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagt
ttcaagagccggggcaactgtcagacccaaggggactccatcctggactgcgtgcccaag
gacgggcagagccactgctgcatcccacgcaaacacctgctgttgtaccagaatatgggc
atctgggtgcaggcagagaatgcgctggggaccagcatgtccccacaactgtgtcttgat
cccatggatgttgtgaaactggagccccccatgctgcggaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagctgtgctgggagccatggcagccaggcctg
cacataaatcagaagtgtgagctgcgccacaagccgcagcgtggagaagccagctgggca
ctggtgggccccctccccttggaggcccttcagtatgagctctgcgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcccctgcctggccactggagcgac
tggagccccagcctggagctgagaactaccgaacgggcccccactgtcagactggacaca
tggtggcggcagaggcagctggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacggatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccacctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctctcgtcccact
ccggtggtcttctcagaaagcagaggcccagctctgaccagactccatgccatggcccga
gaccctcacagcctctgggtaggctgggagccccccaatccatggcctcagggctatgtg
attgagtggggcctgggcccccccagcgcgagcaatagcaacaagacctggaggatggaa
cagaatgggagagccacggggtttctgctgaaggagaacatcaggccctttcagctctat
gagatcatcgtgactcccttgtaccaggacaccatgggaccctcccagcatgtctatgcc
tactctcaagaaatggctccctcccatgccccagagctgcatctaaagcacattggcaag
acctgggcacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaacgctcagaaccagtccttctccgccatcctgaatgcc
tcctcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacatccacctc
atggctgccagccaggctggggccaccaacagtacagtcctcaccctgatgaccttgacc
ccagaggggtcggagctacacatcatcctgggcctgttcggcctcctgctgttgctcacc
tgcctctgtggaactgcctggctctgttgcagccccaacaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctgggctcctgggtgcccacaatcatggaggag
gatgccttccagctgcccggccttggcacgccacccatcaccaagctcacagtgctggag
gaggatgaaaagaagccggtgccctgggagtcccataacagctcagagacctgtggcctc
cccactctggtccagacctatgtgctccagggggacccaagagcagtttccacccagccc
caatcccagtctggcaccagcgatcaggtcctttatgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgtgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccttggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcaacttcccc
ctcctgcaggggatccgggtccatgggatggaggcgctggggagcttctag

KEGG   Homo sapiens (human): 2057
Entry
2057              CDS       T01001                                 
Symbol
EPOR, EPO-R
Name
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04148  Efferocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
nt06535  Efferocytosis
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
N01751  Macrophage EPO signaling
Disease
H00236  Congenital polycythemia
Drug target
Darbepoetin alfa: D03651<JP/US>
Erythropoietin (DG00177): D03231<JP/US> D03232<JP> D04032 D10000 D10846 D10847
Methoxy polyethylene glycol-epoetin beta: D09998<JP/US>
Peginesatide (DG00178): D09946 D09947
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2057 (EPOR)
   04151 PI3K-Akt signaling pathway
    2057 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2057 (EPOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    2057 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2057 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2057 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    2057 (EPOR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   2057 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 2057
NCBI-ProteinID: NP_000112
OMIM: 133171
HGNC: 3416
Ensembl: ENSG00000187266
UniProt: P19235
Structure
LinkDB
Position
19:complement(11377207..11384314)
AA seq 508 aa
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggaccacctcggggcgtccctctggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcctaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggcggcccgggggcccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagcgctggggtgggcccgggcaactacagcttctcc
taccagctcgaggatgagccatggaagctgtgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcctacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtgtcatccacatcaat
gaagtagtgctcctagacgcccccgtggggctggtggcgcggttggctgacgagagcggc
cacgtagtgttgcgctggctcccgccgcctgagacacccatgacgtctcacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtacagagggtggagatcctggag
ggccgcaccgagtgtgtgctgagcaacctgcggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagcgacctggaccccctcatcctgacgctctccctcatcctcgtg
gtcatcctggtgctgctgaccgtgctcgcgctgctctcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagcgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaatgatggctgcctgtggtggagcccctgc
acccccttcacggaggacccacctgcttccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccagtgggc
agtgagcatgcccaggatacctatctggtgctggacaaatggttgctgccccggaacccg
cccagtgaggacctcccagggcctggtggcagtgtggacatagtggccatggatgaaggc
tcagaagcatcctcctgctcatctgctttggcctcgaagcccagcccagagggagcctct
gctgccagctttgagtacactatcctggaccccagctcccagctcttgcgtccatggaca
ctgtgccctgagctgccccctaccccaccccacctaaagtacctgtaccttgtggtatct
gactctggcatctcaactgactacagctcaggggactcccagggagcccaagggggctta
tccgatggcccctactccaacccttatgagaacagccttatcccagccgctgagcctctg
ccccccagctatgtggcttgctcttag

KEGG   Homo sapiens (human): 2690
Entry
2690              CDS       T01001                                 
Symbol
GHR, GHBP, GHIP
Name
(RefSeq) growth hormone receptor
  KO
K05080  growth hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
nt06518  JAK-STAT signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Disease
H00155  Familial hypercholesterolemia
H00254  Growth hormone deficiency
H02037  Laron syndrome
Drug target
Atesidorsen: D11161
Atesidorsen sodium: D11162
Lonapegsomatropin: D11486<US>
Mecasermin: D03297<JP/US>
Mecasermin rinfabate: D04870
Pegvisomant: D05394<JP/US>
Somapacitan: D11194<JP/US>
Somatrem: D05884
Somatrogon: D10990<JP/US>
Somatropin: D02691<JP/US>
Somavaratan: D11193
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2690 (GHR)
   04151 PI3K-Akt signaling pathway
    2690 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2690 (GHR)
   04060 Cytokine-cytokine receptor interaction
    2690 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2690 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    2690 (GHR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   2690 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3 CRLF2-like_D2
Other DBs
NCBI-GeneID: 2690
NCBI-ProteinID: NP_000154
OMIM: 600946
HGNC: 4263
Ensembl: ENSG00000112964
UniProt: P10912
Structure
LinkDB
Position
5:42423439..42721878
AA seq 638 aa
MDLWQLLLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTS
IWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNY
GEFSEVLYVTLPQMSQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGIDPDLLKEGKLEEVNTILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKTEES
DTDRLLSSDHEKSHSNLGVKDGDSGRTSCCEPDILETDFNANDIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNNSPYHDACPATQQPSVIQAEKNKPQPLPTEGAESTHQAAHIQLSNPSS
LSNIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHPEMVSLCQENFLMDNAYFCEADA
KKCIPVAPHIKVESHIQPSLNQEDIYITTESLTTAAGRPGTGEHVPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPDKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggaagtgaggccacagcagctatccttagcagagcaccctggagtctgcaaagtgttaat
ccaggcctaaagacaaattcttctaaggagcctaaattcaccaagtgccgttcacctgag
cgagagactttttcatgccactggacagatgaggttcatcatggtacaaagaacctagga
cccatacagctgttctataccagaaggaacactcaagaatggactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcgtttacctcc
atctggataccttattgtatcaagctaactagcaatggtggtacagtggatgaaaagtgt
ttctctgttgatgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatatccaagtgagatgggaagcaccacgcaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggaccctatattgacaacatcagttccagtgtactcattg
aaagtggataaggaatatgaagtgcgtgtgagatccaaacaacgaaactctggaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgagccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttgggctaacagtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaatcgatccagatctcctcaaggaaggaaaattagag
gaggtgaacacaatcttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagactgaggaatca
gacacagacagacttctaagcagtgaccatgagaaatcacatagtaacctaggggtgaag
gatggcgactctggacgtaccagctgttgtgaacctgacattctggagactgatttcaat
gccaatgacatacatgagggtacctcagaggttgctcagccacagaggttaaaaggggaa
gcagatctcttatgccttgaccagaagaatcaaaataactcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgaaggagctgagtcaactcaccaagctgcccatattcagctaagcaatccaagttca
ctgtcaaacatcgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccgggccaaaagaataaggcagggatgtcccaatgtgacatgcacccggaaatg
gtctcactctgccaagaaaacttccttatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacatcaaggttgaatcacacatacagccaagctta
aaccaagaggacatttacatcaccacagaaagccttaccactgctgctgggaggcctggg
acaggagaacatgttccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcgactgccttgcccttgcctgacaaagag
tttctctcatcatgtggctatgtgagcacagaccaactgaacaaaatcatgccttag

KEGG   Homo sapiens (human): 3953
Entry
3953              CDS       T01001                                 
Symbol
LEPR, CD295, LEP-R, LEPRD, OB-R, OBR
Name
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04152  AMPK signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
Network
nt06325  Hormone/cytokine signaling
nt06518  JAK-STAT signaling
  Element
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
N01800  LEP-LEPR signaling pathway
Disease
H02060  Leptin receptor deficiency
Drug target
Metreleptin: D05014<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3953 (LEPR)
   04152 AMPK signaling pathway
    3953 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3953 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    3953 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    3953 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    3953 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3953 (LEPR)
   04090 CD molecules [BR:hsa04090]
    3953 (LEPR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   3953 (LEPR)
CD molecules [BR:hsa04090]
 Proteins
  3953 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 3953
NCBI-ProteinID: NP_002294
OMIM: 601007
HGNC: 6554
Ensembl: ENSG00000116678
UniProt: P48357
Structure
LinkDB
Position
1:65420652..65641559
AA seq 1165 aa
MICQKFCVVLLHWEFIYVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNS
NGHYETAVEPKFNSSGTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSLVF
QQIDANWNIQCWLKGDLKLFICYVESLFKNLFRNYNYKVHLLYVLPEVLEDSPLVPQKGS
FQMVHCNCSVHECCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPP
LGLHMEITDDGNLKISWSSPPLVPFPLQYQVKYSENSTTVIREADKIVSATSLLVDSILP
GSSYEVQVRGKRLDGPGIWSDWSTPRVFTTQDVIYFPPKILTSVGSNVSFHCIYKKENKI
VPSKEIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHH
RYAELYVIDVNINISCETDGYLTKMTCRWSTSTIQSLAESTLQLRYHRSSLYCSDIPSIH
PISEPKDCYLQSDGFYECIFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPP
SSVKAEITINIGLLKISWEKPVFPENNLQFQIRYGLSGKEVQWKMYEVYDAKSKSVSLPV
PDLCAVYAVQVRCKRLDGLGYWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNV
TLLWKPLMKNDSLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSI
GASVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVIVSWILSPSDYKLMYFIIEWKNLNED
GEIKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDDIEKHQSDA
GLYVIVPVIISSSILLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHLFI
KHTASVTCGPLLLEPETISEDISVDTSWKNKDEMMPTTVVSLLSTTDLEKGSVCISDQFN
SVNFSEAEGTEVTYEDESQRQPFVKYATLISNSKPSETGEEQGLINSSVTKCFSSKNSPL
KDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDKKSIYYL
GVTSIKKRESGVLLTDKSRVSCPFPAPCLFTDIRVLQDSCSHFVENNINLGTSSKKTFAS
YMPQFQTCSTQTHKIMENKMCDLTV
NT seq 3498 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggttttgttacattgggaatttatttatgtgataact
gcgtttaacttgtcatatccaattactccttggagatttaagttgtcttgcatgccacca
aattcaacctatgactacttccttttgcctgctggactctcaaagaatacttcaaattcg
aatggacattatgagacagctgttgaacctaagtttaattcaagtggtactcacttttct
aacttatccaaaacaactttccactgttgctttcggagtgagcaagatagaaactgctcc
ttatgtgcagacaacattgaaggaaagacatttgtttcaacagtaaattctttagttttt
caacaaatagatgcaaactggaacatacagtgctggctaaaaggagacttaaaattattc
atctgttatgtggagtcattatttaagaatctattcaggaattataactataaggtccat
cttttatatgttctgcctgaagtgttagaagattcacctctggttccccaaaaaggcagt
tttcagatggttcactgcaattgcagtgttcatgaatgttgtgaatgtcttgtgcctgtg
ccaacagccaaactcaacgacactctccttatgtgtttgaaaatcacatctggtggagta
attttccagtcacctctaatgtcagttcagcccataaatatggtgaagcctgatccacca
ttaggtttgcatatggaaatcacagatgatggtaatttaaagatttcttggtccagccca
ccattggtaccatttccacttcaatatcaagtgaaatattcagagaattctacaacagtt
atcagagaagctgacaagattgtctcagctacatccctgctagtagacagtatacttcct
gggtcttcgtatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagt
gactggagtactcctcgtgtctttaccacacaagatgtcatatactttccacctaaaatt
ctgacaagtgttgggtctaatgtttcttttcactgcatctataagaaggaaaacaagatt
gttccctcaaaagagattgtttggtggatgaatttagctgagaaaattcctcaaagccag
tatgatgttgtgagtgatcatgttagcaaagttacttttttcaatctgaatgaaaccaaa
cctcgaggaaagtttacctatgatgcagtgtactgctgcaatgaacatgaatgccatcat
cgctatgctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatggg
tacttaactaaaatgacttgcagatggtcaaccagtacaatccagtcacttgcggaaagc
actttgcaattgaggtatcataggagcagcctttactgttctgatattccatctattcat
cccatatctgagcccaaagattgctatttgcagagtgatggtttttatgaatgcattttc
cagccaatcttcctattatctggctacacaatgtggattaggatcaatcactctctaggt
tcacttgactctccaccaacatgtgtccttcctgattctgtggtgaagccactgcctcca
tccagtgtgaaagcagaaattactataaacattggattattgaaaatatcttgggaaaag
ccagtctttccagagaataaccttcaattccagattcgctatggtttaagtggaaaagaa
gtacaatggaagatgtatgaggtttatgatgcaaaatcaaaatctgtcagtctcccagtt
ccagacttgtgtgcagtctatgctgttcaggtgcgctgtaagaggctagatggactggga
tattggagtaattggagcaatccagcctacacagttgtcatggatataaaagttcctatg
agaggacctgaattttggagaataattaatggagatactatgaaaaaggagaaaaatgtc
actttactttggaagcccctgatgaaaaatgactcattgtgcagtgttcagagatatgtg
ataaaccatcatacttcctgcaatggaacatggtcagaagatgtgggaaatcacacgaaa
ttcactttcctgtggacagagcaagcacatactgttacggttctggccatcaattcaatt
ggtgcttctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatc
gtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattgtttcctggatacta
tcacccagtgattacaagctaatgtattttattattgagtggaaaaatcttaatgaagat
ggtgaaataaaatggcttagaatctcttcatctgttaagaagtattatatccatgatcat
tttatccccattgagaagtaccagttcagtctttacccaatatttatggaaggagtggga
aaaccaaagataattaatagtttcactcaagatgatattgaaaaacaccagagtgatgca
ggtttatatgtaattgtgccagtaattatttcctcttccatcttattgcttggaacatta
ttaatatcacaccaaagaatgaaaaagctattttgggaagatgttccgaaccccaagaat
tgttcctgggcacaaggacttaattttcagaagccagaaacgtttgagcatctttttatc
aagcatacagcatcagtgacatgtggtcctcttcttttggagcctgaaacaatttcagaa
gatatcagtgttgatacatcatggaaaaataaagatgagatgatgccaacaactgtggtc
tctctactttcaacaacagatcttgaaaagggttctgtttgtattagtgaccagttcaac
agtgttaacttctctgaggctgagggtactgaggtaacctatgaggacgaaagccagaga
caaccctttgttaaatacgccacgctgatcagcaactctaaaccaagtgaaactggtgaa
gaacaagggcttataaatagttcagtcaccaagtgcttctctagcaaaaattctccgttg
aaggattctttctctaatagctcatgggagatagaggcccaggcattttttatattatca
gatcagcatcccaacataatttcaccacacctcacattctcagaaggattggatgaactt
ttgaaattggagggaaatttccctgaagaaaataatgataaaaagtctatctattattta
ggggtcacctcaatcaaaaagagagagagtggtgtgcttttgactgacaagtcaagggta
tcgtgcccattcccagccccctgtttattcacggacatcagagttctccaggacagttgc
tcacactttgtagaaaataatatcaacttaggaacttctagtaagaagacttttgcatct
tacatgcctcaattccaaacttgttctactcagactcataagatcatggaaaacaagatg
tgtgacctaactgtgtaa

KEGG   Homo sapiens (human): 4352
Entry
4352              CDS       T01001                                 
Symbol
MPL, C-MPL, CD110, MPLV, THCYT2, THPOR, TPOR
Name
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Disease
H00227  Congenital amegakaryocytic thrombocytopenia
H01605  Myelofibrosis
H01612  Essential thrombocythemia
Drug target
Avatrombopag (DG01976): D10306 D10307<JP/US>
Eltrombopag: D03978<JP/US>
Lusutrombopag: D10476<JP/US>
Romiplostim: D08990<JP/US>
Totrombopag choline: D09024
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    4352 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4352 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4352 (MPL)
   04090 CD molecules [BR:hsa04090]
    4352 (MPL)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   4352 (MPL)
CD molecules [BR:hsa04090]
 Proteins
  4352 (MPL)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind LIFR_N POU2F1_C
Other DBs
NCBI-GeneID: 4352
NCBI-ProteinID: NP_005364
OMIM: 159530
HGNC: 7217
Ensembl: ENSG00000117400
UniProt: P40238
Structure
LinkDB
Position
1:43337818..43354466
AA seq 635 aa
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgccctcctgggccctcttcatggtcacctcctgcctcctcctggcccctcaaaacctg
gcccaagtcagcagccaagatgtctccttgctggcatcagactcagagcccctgaagtgt
ttctcccgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcgcccagt
gggacataccagctgctgtatgcctacccgcgggagaagccccgtgcttgccccctgagt
tcccagagcatgccccactttggaacccgatacgtgtgccagtttccagaccaggaggaa
gtgcgtctcttctttccgctgcacctctgggtgaagaatgtgttcctaaaccagactcgg
actcagcgagtcctctttgtggacagtgtaggcctgccggctccccccagtatcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggagccagctccagaa
atcagtgatttcctgaggtacgaactccgctatggccccagagatcccaagaactccact
ggtcccacggtcatacagctgattgccacagaaacctgctgccctgctctgcagaggcct
cactcagcctctgctctggaccagtctccatgtgctcagcccacaatgccctggcaagat
ggaccaaagcagacctccccaagtagagaagcttcagctctgacagcagagggtggaagc
tgcctcatctcaggactccagcctggcaactcctactggctgcagctgcgcagcgaacct
gatgggatctccctcggtggctcctggggatcctggtccctccctgtgactgtggacctg
cctggagatgcagtggcacttggactgcaatgctttaccttggacctgaagaatgttacc
tgtcaatggcagcaacaggaccatgctagctcccaaggcttcttctaccacagcagggca
cggtgctgccccagagacaggtaccccatctgggagaactgcgaagaggaagagaaaaca
aatccaggactacagaccccacagttctctcgctgccacttcaagtcacgaaatgacagc
attattcacatccttgtggaggtgaccacagccccgggtactgttcacagctacctgggc
tcccctttctggatccaccaggctgtgcgcctccccaccccaaacttgcactggagggag
atctccagtgggcatctggaattggagtggcagcacccatcgtcctgggcagcccaagag
acctgttatcaactccgatacacaggagaaggccatcaggactggaaggtgctggagccg
cctctcggggcccgaggagggaccctggagctgcgcccgcgatctcgctaccgtttacag
ctgcgcgccaggctcaacggccccacctaccaaggtccctggagctcgtggtcggaccca
actagggtggagaccgccaccgagaccgcctggatctccttggtgaccgctctgcatcta
gtgctgggcctcagcgccgtcctgggcctgctgctgctgaggtggcagtttcctgcacac
tacaggagactgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggc
cagtaccttagggacactgcagccctgagcccgcccaaggccacagtctcagatacctgt
gaagaagtggaacccagcctccttgaaatcctccccaagtcctcagagaggactcctttg
cccctgtgttcctcccaggcccagatggactaccgaagattgcagccttcttgcctgggg
accatgcccctgtctgtgtgcccacccatggctgagtcagggtcctgctgtaccacccac
attgccaaccattcctacctaccactaagctattggcagcagccttga

KEGG   Homo sapiens (human): 5618
Entry
5618              CDS       T01001                                 
Symbol
PRLR, HPRL, MFAB, RI-PRLR, hPRLrI
Name
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Network
nt06325  Hormone/cytokine signaling
nt06518  JAK-STAT signaling
  Element
N00920  PRL-JAK-STAT signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Disease
H01388  Hyperprolactinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    5618 (PRLR)
   04151 PI3K-Akt signaling pathway
    5618 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5618 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    5618 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    5618 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    5618 (PRLR)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   5618 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind CRLF2_D1 GHBP MOV-10_Ig-like
Other DBs
NCBI-GeneID: 5618
NCBI-ProteinID: NP_000940
OMIM: 176761
HGNC: 9446
Ensembl: ENSG00000113494
UniProt: P16471
Structure
LinkDB
Position
5:complement(35048756..35230487)
AA seq 622 aa
MKENVASATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
EIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQ
PSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREVE
SFHSETDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALSLLPKQRENSGKPKKPGTP
ENNKEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEKALANFTATSS
KCRLQLGGLDYLDPACFTHSFH
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgtggcatctgcaaccgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctcctggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcactgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataacc
ggtggccccaactcctgccactttggcaagcagtacacctccatgtggaggacatacatc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactttatgtggac
gtgacttacatagttcagccagaccctcctttggagctggctgtggaagtaaaacagcca
gaagacagaaaaccctacctgtggattaaatggtctccacctaccctgattgacttaaaa
actggttggttcacgctcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagatccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagaccatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcaccatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccgccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagatgatagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgtgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaatcccctattttcatgctggtggatccaaatgttcaacatggcccttaccacag
cccagccagcacaaccccagatcctcttaccacaatattactgatgtgtgtgagctggct
gtgggccctgcaggtgcaccggccactctgttgaatgaagcaggtaaagatgctttaaaa
tcctctcaaaccattaagtctagagaagagggaaaggcaacccagcagagggaggtagaa
agcttccattctgagactgaccaggatacgccctggctgctgccccaggagaaaaccccc
tttggctccgctaaacccttggattatgtggagattcacaaggtcaacaaagatggtgca
ttatcattgctaccaaaacagagagagaacagcggcaagcccaagaagcccgggactcct
gagaacaataaggagtatgccaaggtgtccggggtcatggataacaacatcctggtgttg
gtgccagatccacatgctaaaaacgtggcttgctttgaagaatcagccaaagaggcccca
ccatcacttgaacagaatcaagctgagaaagccctggccaacttcactgcaacatcaagc
aagtgcaggctccagctgggtggtttggattacctggatcccgcatgttttacacactcc
tttcactga

DBGET integrated database retrieval system