KEGG   Homo sapiens (human): 4609
Entry
4609              CDS       T01001                                 
Symbol
MYC, MRTL, MYCC, bHLHe39, c-Myc
Name
(RefSeq) MYC proto-oncogene, bHLH transcription factor
  KO
K04377  Myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  JAK-STAT signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05132  Salmonella infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05216  Thyroid cancer
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06115  WNT signaling (viruses and bacteria)
nt06130  Cell cycle (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06210  ERK signaling
nt06215  WNT signaling
nt06227  Nuclear receptor signaling
nt06230  Cell cycle
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06267  Small cell lung cancer
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
  Element
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00110  PLZF-RARA fusion to transcriptional activtion
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
N00489  HTLV-1 p30II to c-myc-mediated transcription
N00512  HTLV-1 Tax to c-myc-mediated transcription
N00529  HCV core to RXRA/PPARA-mediated transcription
N00530  HCV core to RXRA/LXRA-mediated transcription
N01124  Salmonella AvrA to beta-catenin signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
Disease
H00001  B-cell acute lymphoblastic leukemia
H00002  T-cell acute lymphoblastic leukemia
H00008  Burkitt lymphoma
H00010  Multiple myeloma
H00013  Small cell lung cancer
H00016  Oral cancer
H00025  Penile cancer
H00027  Ovarian cancer
H00028  Choriocarcinoma
H00036  Osteosarcoma
H00041  Kaposi sarcoma
H00048  Hepatocellular carcinoma
H00055  Laryngeal cancer
H01463  Mycosis fungoides
H01509  Tonsillar cancer
H01554  Fallopian tube cancer
H01667  Medulloblastoma
H02434  Diffuse large B-cell lymphoma, not otherwise specified
Drug target
Omacetaxine mepesuccinate: D08956<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4609 (MYC)
   04012 ErbB signaling pathway
    4609 (MYC)
   04310 Wnt signaling pathway
    4609 (MYC)
   04350 TGF-beta signaling pathway
    4609 (MYC)
   04390 Hippo signaling pathway
    4609 (MYC)
   04630 JAK-STAT signaling pathway
    4609 (MYC)
   04151 PI3K-Akt signaling pathway
    4609 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4609 (MYC)
   04218 Cellular senescence
    4609 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4609 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4609 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4609 (MYC)
   05202 Transcriptional misregulation in cancer
    4609 (MYC)
   05206 MicroRNAs in cancer
    4609 (MYC)
   05205 Proteoglycans in cancer
    4609 (MYC)
   05207 Chemical carcinogenesis - receptor activation
    4609 (MYC)
   05230 Central carbon metabolism in cancer
    4609 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    4609 (MYC)
   05225 Hepatocellular carcinoma
    4609 (MYC)
   05226 Gastric cancer
    4609 (MYC)
   05216 Thyroid cancer
    4609 (MYC)
   05221 Acute myeloid leukemia
    4609 (MYC)
   05220 Chronic myeloid leukemia
    4609 (MYC)
   05219 Bladder cancer
    4609 (MYC)
   05213 Endometrial cancer
    4609 (MYC)
   05224 Breast cancer
    4609 (MYC)
   05222 Small cell lung cancer
    4609 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4609 (MYC)
   05161 Hepatitis B
    4609 (MYC)
   05160 Hepatitis C
    4609 (MYC)
   05163 Human cytomegalovirus infection
    4609 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4609 (MYC)
   05169 Epstein-Barr virus infection
    4609 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    4609 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4609 (MYC)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4609 (MYC)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4609 (MYC)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4609 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 4609
NCBI-ProteinID: NP_002458
OMIM: 190080
HGNC: 7553
Ensembl: ENSG00000136997
Pharos: P01106(Tbio)
UniProt: P01106
Structure
LinkDB
Position
8:127735434..127742951
AA seq 454 aa
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
NT seq 1365 nt   +upstreamnt  +downstreamnt
ctggatttttttcgggtagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacacccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcgcctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgtcaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

KEGG   Homo sapiens (human): 8295
Entry
8295              CDS       T01001                                 
Symbol
TRRAP, DEDDFA, DFNA75, PAF350/400, PAF400, STAF40, TR-AP, Tra1
Name
(RefSeq) transformation/transcription domain associated protein
  KO
K08874  transformation/transcription domain-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00489  HTLV-1 p30II to c-myc-mediated transcription
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8295 (TRRAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8295 (TRRAP)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8295 (TRRAP)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8295 (TRRAP)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   8295 (TRRAP)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8295 (TRRAP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     8295 (TRRAP)
    STAGA complex
     8295 (TRRAP)
    TFTC complex
     8295 (TRRAP)
    TIP60 complex
     8295 (TRRAP)
    SAGA complex
     8295 (TRRAP)
    SLIK complex
     8295 (TRRAP)
    NuA4 complex
     8295 (TRRAP)
  Chromatin remodeling factors
   ASTRA complex
    8295 (TRRAP)
SSDB
Motif
Pfam: Tra1_ring Tra1_central FAT PI3_PI4_kinase FATC DEC-1_N BALF1 Polysacc_deac_1
Other DBs
NCBI-GeneID: 8295
NCBI-ProteinID: NP_001231509
OMIM: 603015
HGNC: 12347
Ensembl: ENSG00000196367
Pharos: Q9Y4A5(Tbio)
UniProt: Q9Y4A5
LinkDB
Position
7:98878532..99013241
AA seq 3859 aa
MAFVATQGATVVDQTTLMKKYLQFVAALTDVNTPDETKLKMMQEVSENFENVTSSPQYST
FLEHIIPRFLTFLQDGEVQFLQEKPAQQLRKLVLEIIHRIPTNEHLRPHTKNVLSVMFRF
LETENEENVLICLRIIIELHKQFRPPITQEIHHFLDFVKQIYKELPKVVNRYFENPQVIP
ENTVPPPEMVGMITTIAVKVNPEREDSETRTHSIIPRGSLSLKVLAELPIIVVLMYQLYK
LNIHNVVAEFVPLIMNTIAIQVSAQARQHKLYNKELYADFIAAQIKTLSFLAYIIRIYQE
LVTKYSQQMVKGMLQLLSNCPAETAHLRKELLIAAKHILTTELRNQFIPCMDKLFDESIL
IGSGYTARETLRPLAYSTLADLVHHVRQHLPLSDLSLAVQLFAKNIDDESLPSSIQTMSC
KLLLNLVDCIRSKSEQESGNGRDVLMRMLEVFVLKFHTIARYQLSAIFKKCKPQSELGAV
EAALPGVPTAPAAPGPAPSPAPVPAPPPPPPPPPPATPVTPAPVPPFEKQGEKDKEDKQT
FQVTDCRSLVKTLVCGVKTITWGITSCKAPGEAQFIPNKQLQPKETQIYIKLVKYAMQAL
DIYQVQIAGNGQTYIRVANCQTVRMKEEKEVLEHFAGVFTMMNPLTFKEIFQTTVPYMVE
RISKNYALQIVANSFLANPTTSALFATILVEYLLDRLPEMGSNVELSNLYLKLFKLVFGS
VSLFAAENEQMLKPHLHKIVNSSMELAQTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFL
PLLPNLLQGLNMLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYLPMLMDPLVSALNGSQT
LVSQGLRTLELCVDNLQPDFLYDHIQPVRAELMQALWRTLRNPADSISHVAYRVLGKFGG
SNRKMLKESQKLHYVVTEVQGPSITVEFSDCKASLQLPMEKAIETALDCLKSANTEPYYR
RQAWEVIKCFLVAMMSLEDNKHALYQLLAHPNFTEKTIPNVIISHRYKAQDTPARKTFEQ
ALTGAFMSAVIKDLRPSALPFVASLIRHYTMVAVAQQCGPFLLPCYQVGSQPSTAMFHSE
ENGSKGMDPLVLIDAIAICMAYEEKELCKIGEVALAVIFDVASIILGSKERACQLPLFSY
IVERLCACCYEQAWYAKLGGVVSIKFLMERLPLTWVLQNQQTFLKALLFVMMDLTGEVSN
GAVAMAKTTLEQLLMRCATPLKDEERAEEIVAAQEKSFHHVTHDLVREVTSPNSTVRKQA
MHSLQVLAQVTGKSVTVIMEPHKEVLQDMVPPKKHLLRHQPANAQIGLMEGNTFCTTLQP
RLFTMDLNVVEHKVFYTELLNLCEAEDSALTKLPCYKSLPSLVPLRIAALNALAACNYLP
QSREKIIAALFKALNSTNSELQEAGEACMRKFLEGATIEVDQIHTHMRPLLMMLGDYRSL
TLNVVNRLTSVTRLFPNSFNDKFCDQMMQHLRKWMEVVVITHKGGQRSDGNESISECGRC
PLSPFCQFEEMKICSAIINLFHLIPAAPQTLVKPLLEVVMKTERAMLIEAGSPFREPLIK
FLTRHPSQTVELFMMEATLNDPQWSRMFMSFLKHKDARPLRDVLAANPNRFITLLLPGGA
QTAVRPGSPSTSTMRLDLQFQAIKIISIIVKNDDSWLASQHSLVSQLRRVWVSENFQERH
RKENMAATNWKEPKLLAYCLLNYCKRNYGDIELLFQLLRAFTGRFLCNMTFLKEYMEEEI
PKNYSIAQKRALFFRFVDFNDPNFGDELKAKVLQHILNPAFLYSFEKGEGEQLLGPPNPE
GDNPESITSVFITKVLDPEKQADMLDSLRIYLLQYATLLVEHAPHHIHDNNKNRNSKLRR
LMTFAWPCLLSKACVDPACKYSGHLLLAHIIAKFAIHKKIVLQVFHSLLKAHAMEARAIV
RQAMAILTPAVPARMEDGHQMLTHWTRKIIVEEGHTVPQLVHILHLIVQHFKVYYPVRHH
LVQHMVSAMQRLGFTPSVTIEQRRLAVDLSEVVIKWELQRIKDQQPDSDMDPNSSGEGVN
SVSSSIKRGLSVDSAQEVKRFRTATGAISAVFGRSQSLPGADSLLAKPIDKQHTDTVVNF
LIRVACQVNDNTNTAGSPGEVLSRRCVNLLKTALRPDMWPKSELKLQWFDKLLMTVEQPN
QVNYGNICTGLEVLSFLLTVLQSPAILSSFKPLQRGIAACMTCGNTKVLRAVHSLLSRLM
SIFPTEPSTSSVASKYEELECLYAAVGKVIYEGLTNYEKATNANPSQLFGTLMILKSACS
NNPSYIDRLISVFMRSLQKMVREHLNPQAASGSTEATSGTSELVMLSLELVKTRLAVMSM
EMRKNFIQAILTSLIEKSPDAKILRAVVKIVEEWVKNNSPMAANQTPTLREKSILLVKMM
TYIEKRFPEDLELNAQFLDLVNYVYRDETLSGSELTAKLEPAFLSGLRCAQPLIRAKFFE
VFDNSMKRRVYERLLYVTCSQNWEAMGNHFWIKQCIELLLAVCEKSTPIGTSCQGAMLPS
ITNVINLADSHDRAAFAMVTHVKQEPRERENSESKEEDVEIDIELAPGDQTSTPKTKELS
EKDIGNQLHMLTNRHDKFLDTLREVKTGALLSAFVQLCHISTTLAEKTWVQLFPRLWKIL
SDRQQHALAGEISPFLCSGSHQVQRDCQPSALNCFVEAMSQCVPPIPIRPCVLKYLGKTH
NLWFRSTLMLEHQAFEKGLSLQIKPKQTTEFYEQESITPPQQEILDSLAELYSLLQEEDM
WAGLWQKRCKYSETATAIAYEQHGFFEQAQESYEKAMDKAKKEHERSNASPAIFPEYQLW
EDHWIRCSKELNQWEALTEYGQSKGHINPYLVLECAWRVSNWTAMKEALVQVEVSCPKEM
AWKVNMYRGYLAICHPEEQQLSFIERLVEMASSLAIREWRRLPHVVSHVHTPLLQAAQQI
IELQEAAQINAGLQPTNLGRNNSLHDMKTVVKTWRNRLPIVSDDLSHWSSIFMWRQHHYQ
GKPTWSGMHSSSIVTAYENSSQHDPSSNNAMLGVHASASAIIQYGKIARKQGLVNVALDI
LSRIHTIPTVPIVDCFQKIRQQVKCYLQLAGVMGKNECMQGLEVIESTNLKYFTKEMTAE
FYALKGMFLAQINKSEEANKAFSAAVQMHDVLVKAWAMWGDYLENIFVKERQLHLGVSAI
TCYLHACRHQNESKSRKYLAKVLWLLSFDDDKNTLADAVDKYCIGVPPIQWLAWIPQLLT
CLVGSEGKLLLNLISQVGRVYPQAVYFPIRTLYLTLKIEQRERYKSDPGPIRATAPMWRC
SRIMHMQRELHPTLLSSLEGIVDQMVWFRENWHEEVLRQLQQGLAKCYSVAFEKSGAVSD
AKITPHTLNFVKKLVSTFGVGLENVSNVSTMFSSAASESLARRAQATAQDPVFQKLKGQF
TTDFDFSVPGSMKLHNLISKLKKWIKILEAKTKQLPKFFLIEEKCRFLSNFSAQTAEVEI
PGEFLMPKPTHYYIKIARFMPRVEIVQKHNTAARRLYIRGHNGKIYPYLVMNDACLTESR
REERVLQLLRLLNPCLEKRKETTKRHLFFTVPRVVAVSPQMRLVEDNPSSLSLVEIYKQR
CAKKGIEHDNPISRYYDRLATVQARGTQASHQVLRDILKEVQSNMVPRSMLKEWALHTFP
NATDYWTFRKMFTIQLALIGFAEFVLHLNRLNPEMLQIAQDTGKLNVAYFRFDINDATGD
LDANRPVPFRLTPNISEFLTTIGVSGPLTASMIAVARCFAQPNFKVDGILKTVLRDEIIA
WHKKTQEDTSSPLSAAGQPENMDSQQLVSLVQKAVTAIMTRLHNLAQFEGGESKVNTLVA
AANSLDNLCRMDPAWHPWL
NT seq 11580 nt   +upstreamnt  +downstreamnt
atggcgtttgttgcaacacagggggccacggtggttgaccagaccactttgatgaaaaag
taccttcagtttgtggcagctctcacagatgtgaatacacctgatgaaacaaagttgaaa
atgatgcaagaagttagtgaaaattttgagaatgtcacgtcatctcctcagtattctaca
ttcctagaacatatcatccctcgattccttacatttctccaagatggagaagttcagttt
cttcaggagaaaccagcacagcaactgcggaagctcgtacttgaaataattcatagaata
ccaaccaacgaacatcttcgtcctcacacaaaaaatgttttgtctgtgatgtttcgcttt
ttagagacggaaaatgaagaaaatgttcttatttgtctaagaataattattgagctacac
aaacagttcaggccaccgatcacacaagaaattcatcattttctggattttgtgaaacag
atttacaaggagcttccaaaagtagtgaaccgctactttgagaaccctcaagtgatcccc
gagaacacagtgcctcccccagaaatggttggtatgataacaacgattgctgtgaaagtc
aacccggagcgtgaggacagtgagactcgaacacattccatcattccgaggggatcactt
tctctgaaagtgttggcagaattgcccattattgttgttttaatgtatcagctctacaaa
ctgaacatccacaatgttgttgctgagtttgtgcccttgatcatgaacaccattgccatt
caggtgtctgcacaagcgaggcaacataagctttacaacaaggagttgtatgctgacttc
attgctgctcagattaaaacattgtcatttttagcttacattatcaggatttaccaggag
ttggtgactaagtattctcagcagatggtgaaaggaatgctccagttactttcaaattgt
ccagcagagactgcacacctcagaaaggagcttctgattgctgccaaacacatcctcacc
acagagctgagaaaccagttcattccttgcatggacaagctgtttgatgaatccatacta
attggctcaggatatactgccagagagactctaaggcccctcgcctacagcacgctggcc
gacctcgtgcaccatgtccgccagcacctgcccctcagcgacctctccctcgccgtccag
ctcttcgccaagaacatcgacgatgagtccctgcccagcagcatccagaccatgtcctgc
aagctcctgctgaacctggtggactgcatccgttccaagagcgagcaggagagtggcaat
gggagagacgtcctgatgcggatgctggaggttttcgttctcaaattccacacaattgct
cggtaccagctctctgccatttttaagaagtgtaagcctcagtcagaacttggagccgtg
gaagcagctctgcctggggtgcccactgcccctgcagctcctggccctgctccctcccca
gcccctgtccctgccccacctccacccccgcccccacccccacctgccacccctgtgacc
ccggcccccgtgcctcccttcgagaagcaaggagaaaaggacaaggaagacaagcagaca
ttccaagtcacagactgtcgaagtttggtcaaaaccttggtgtgtggtgtcaagacaatc
acgtggggcataacatcatgcaaagcacctggtgaagctcagttcattcccaacaagcag
ttacaacccaaagagacacagatttacatcaaacttgtgaaatatgcaatgcaagcttta
gatatttatcaggtccagatagcaggaaatggacagacatacatccgtgtggccaactgc
cagactgtgagaatgaaagaggagaaggaggtattggagcatttcgctggtgtgttcaca
atgatgaaccccttaacgttcaaagaaatcttccaaactacggtcccttatatggtggag
agaatctcaaaaaattatgctcttcagattgttgccaattccttcttggcaaatcctact
acctctgctctgtttgctacgattctggtggaatatctccttgatcgcctgccagaaatg
ggctccaacgtggagctctccaacctgtacctcaagctgttcaagctggtctttggctct
gtctccctctttgcagctgaaaatgaacaaatgctgaagcctcacttgcacaagattgtg
aacagctctatggagctcgcgcagactgccaaggaaccctacaactacttcttgctgcta
cgggcgctgtttcgctctattggtggaggtagccacgatctcttgtatcaggagttcttg
cctctccttccaaacctcctgcaagggctgaacatgcttcagagtggcctgcacaagcag
cacatgaaggacctctttgtggagctgtgtctcaccgtccctgtgcggctgagctcgctt
ttgccgtacctgcccatgcttatggatcccttggtgtctgcactcaatgggtctcagaca
ttggtcagccaaggcctcaggacgctggagctgtgtgtggacaacctgcagcccgacttc
ctctacgaccacatccagccggtgcgcgcagagctcatgcaggctctgtggcgcacctta
cgcaaccctgctgacagcatctcccacgtggcctaccgtgtgctcggtaagtttggcggc
agtaacaggaagatgctgaaggagtcgcagaagctgcactacgttgtgaccgaggttcag
ggccccagcatcactgtggagttttccgactgcaaagcttctctccagctccccatggag
aaggccattgaaactgctctggactgcctgaaaagcgccaacactgagccctactaccgg
aggcaggcgtgggaagtgatcaaatgcttcctggtggccatgatgagcctggaggacaac
aagcacgcactctaccagctcctggcacaccccaactttacagaaaagaccatccccaat
gttatcatctcacatcgctacaaagcccaggacactccagcccggaagacttttgagcag
gccctgacaggcgccttcatgtctgctgtcattaaggacctgcggcccagcgccctgccc
tttgtcgccagcttgatccgccactatacgatggtggcagtcgcccagcagtgtggccct
ttcttgctgccttgctaccaggtgggcagccagcccagcacagccatgtttcacagtgaa
gaaaatggctcgaaaggaatggatcctttggttctcattgatgcaattgctatttgtatg
gcatatgaagaaaaggagctttgcaaaatcggggaggtggccctagctgtgatatttgat
gttgcaagtatcatcctgggctccaaggagagggcctgccagctgcccctgttttcttac
atcgtggagcgcctgtgtgcatgttgttatgaacaggcgtggtatgcaaagctggggggt
gtggtgtctattaagtttctcatggagcggctgcctctcacttgggttctccagaaccag
cagacattcctgaaagcacttctctttgtcatgatggacttaactggagaggtttccaat
ggggcagtcgctatggcaaagaccacgctggagcagcttctgatgcggtgcgcaacgcct
ttaaaagacgaggagagagccgaagagatcgtggccgcccaggaaaagtctttccaccat
gtgacacacgacttggttcgagaagtcacctctccaaactccactgtgaggaagcaggcc
atgcattcgctgcaggtgttggcccaggtcactgggaagagtgtcacggtgatcatggaa
ccccacaaagaggtcctgcaggatatggtcccccctaagaagcacctgctccgacaccag
cctgccaacgcacagattggcctgatggaggggaacacgttctgtaccacgttgcagccc
aggctcttcacaatggaccttaacgtggtggagcataaggtgttctacacagagctgttg
aatttgtgtgaggctgaagattcagctttaacaaagctgccctgttataaaagccttccg
tcactcgtacctttacgaattgcggcattaaatgcacttgctgcctgcaattaccttcct
cagtccagggagaaaatcatcgctgcactcttcaaagccctgaattccaccaatagtgag
ctccaagaggccggagaagcctgtatgagaaagtttttagaaggtgctaccatagaagtc
gatcaaatccacacacatatgcgacctttgctgatgatgctgggagattaccggagcttg
acgctgaatgttgtgaatcgcctgacttcggtcacgaggctcttcccaaattccttcaat
gataaattttgtgatcagatgatgcaacatctgcgcaagtggatggaagtggtggtgatc
acccacaaagggggccagaggagcgacggaaacgaaagcatttccgagtgcgggagatgt
cccttgtctccattctgtcagtttgaggaaatgaagatttgctcagcaattataaacctt
tttcatctgatcccggctgctcctcagacactggtgaagcctttgctagaggttgtcatg
aaaacggagcgggcgatgctgatcgaggcggggagtccattccgagagcccctgatcaag
ttcctgactcgacatccctcgcagacagtggagctgttcatgatggaagccacactgaac
gatccccagtggagcagaatgtttatgagttttttaaaacacaaagacgccagacctctg
cgggatgtgctggctgccaaccccaacaggttcatcaccctgctgctgccggggggtgcc
cagacggctgtgcgccccggttcgcccagcaccagcaccatgcgcctggacctccagttc
caggccatcaagatcataagcattatagtgaaaaacgatgactcctggctggccagccag
cactctctggtgagccagttgcgacgtgtgtgggtgagtgagaacttccaagagaggcac
cgcaaggagaacatggcagccaccaactggaaggagcccaagctgctggcctactgcctg
ctgaactactgcaaaaggaattacggagatatagaattgctgttccagctgctccgagcc
tttactggtcgttttctctgcaacatgacattcttaaaagagtatatggaggaagagatt
cccaaaaattacagcatcgctcagaaacgtgccctgttctttcgctttgtagacttcaac
gaccccaacttcggagatgaattaaaagctaaagttctgcagcatatcttgaatcctgct
ttcttgtacagctttgagaagggggaaggagagcagctcttgggacctcccaatccagaa
ggagataacccagaaagcatcaccagtgtgtttattaccaaggtcctggaccccgagaag
caggcggacatgctggactcgctgcggatctacctgctgcagtacgccacgctgctggtg
gagcacgccccccaccacatccatgacaacaacaagaaccgcaacagcaagctgcgccgc
ctcatgaccttcgcctggccctgcctgctctccaaggcctgcgtggacccagcctgcaag
tacagcggacacttgctcctggcgcacattatcgccaaattcgccatacacaagaagatc
gtcctgcaggtttttcatagtctcctcaaggctcacgcaatggaagctcgagcgatcgtc
agacaggcgatggccattctgaccccggcggtgccggccaggatggaggacgggcaccag
atgctgacccactggacccggaagatcattgtggaggaggggcacaccgtcccgcagctg
gtccacattctgcacctgatagtgcaacacttcaaggtgtactacccggtacggcaccac
ttggtgcagcacatggtgagcgccatgcagaggctgggcttcacgcccagtgtcaccatc
gagcagaggcggctggccgtggacctgtctgaagtcgtcatcaagtgggagctgcagagg
atcaaggaccagcagccggattcagatatggacccaaattccagtggagaaggagtcaat
tctgtctcatcctccattaagagaggcctgtccgtggattctgcccaggaagtgaaacgc
tttaggacggccaccggagccatcagtgcagtctttgggaggagccagtcgctacctgga
gcagactctctcctcgccaagcccattgacaagcagcacacagacactgtggtgaacttc
cttatccgcgtggcctgtcaggttaatgacaacaccaacacagcggggtcccctggggag
gtgctctctcgccggtgtgtgaaccttctgaagactgcgttgcggccagacatgtggccc
aagtccgaactcaagctgcagtggttcgacaagctgctgatgactgtggagcagccaaac
caagtgaactatgggaatatctgcacgggcctagaagtgctgagcttcctgctaactgtc
ctccagtccccagccatcctcagtagcttcaaacctctgcagcgtggaattgccgcctgc
atgacatgtggaaacaccaaggtgttgcgagccgtccacagccttctctcgcgcctgatg
agcattttcccaacagagccgagtacttccagtgtggcctccaaatatgaagagctggag
tgcctctacgcagccgtcggaaaggtcatctatgaagggctcaccaactacgagaaggcc
accaatgccaatccctcccagctcttcgggacccttatgatcctcaagtctgcctgcagc
aacaaccccagctacatagacaggctgatctccgtctttatgcgctccctgcagaagatg
gtccgggagcatttaaaccctcaggcagcgtcaggaagcaccgaagccacctcaggtaca
agcgagctggtgatgctgagtctggagctggtgaagacgcgcctggcagtgatgagcatg
gagatgcggaagaacttcatccaggccatcctgacatccctcatcgaaaaatcaccagat
gccaaaatcctccgggctgtggtcaaaatcgtggaagaatgggtcaagaataactcccca
atggcagccaatcagacacctacactccgggagaagtccattttgcttgtgaagatgatg
acttacatagaaaaacgctttccggaagaccttgaattaaatgcccagtttttagatctt
gttaactatgtctacagggatgagaccctctctggcagcgagctgacggcgaaacttgag
cctgcctttctctctgggctgcgctgtgcccagccactcatcagggcaaagtttttcgag
gtttttgacaactccatgaaacgtcgtgtctacgagcgcttgctctatgtgacctgttcg
cagaactgggaagccatggggaaccacttctggatcaagcagtgcattgagctgcttctg
gccgtgtgtgagaagagcacccccattggcaccagctgccaaggagccatgctcccgtcc
atcaccaacgtcatcaacctggccgatagccacgaccgtgccgccttcgccatggtcaca
catgtcaagcaggagccccgggagcgggagaacagcgagtccaaagaggaggatgtagag
atagacatcgaactagctcctggggatcagaccagcacgcccaaaaccaaagaactttca
gaaaaggacattggaaaccagctgcacatgctaaccaacaggcacgacaagtttctggac
actctccgagaggtgaagactggagcgctgctcagcgctttcgttcagctgtgccacatt
tccacgacgctggcagagaagacgtgggtccagcttttccccagattgtggaagatcctc
tctgacagacagcagcatgcactcgcgggtgagataagtccatttctgtgcagcggcagt
caccaggtgcagcgggactgccagcccagcgcgctgaactgctttgtggaagccatgtcc
cagtgcgtgccgccaatccccatccgaccctgcgtcctgaagtacctggggaagacacac
aacctctggttccggtccacgctgatgttggagcaccaggcttttgaaaagggtctgagt
cttcagattaagccgaagcaaacaacggagttttatgagcaggagagcatcaccccgccg
cagcaggagatactggattcccttgcggagctttactccctgttacaagaggaagatatg
tgggctggtctgtggcagaagcggtgcaagtactcggagacagcgactgcgattgcttac
gagcagcacgggttctttgagcaggcacaagaatcctatgaaaaggcaatggataaagcc
aaaaaagaacatgagaggagtaacgcctcccctgctattttccctgaataccagctctgg
gaagaccactggattcgatgctccaaggaattgaaccagtgggaagccctgacggagtac
ggtcagtccaaaggccacatcaacccctacctcgtcctggagtgcgcctggcgggtgtcc
aactggactgccatgaaggaggcgctggtgcaggtggaagtgagctgtccgaaggagatg
gcctggaaggtgaacatgtaccgcggatacctggccatctgccaccccgaggagcagcag
ctcagcttcatcgagcgcctggtggagatggccagcagcctggccatccgcgagtggcgg
cggctgccccacgtagtgtcccacgtgcacacgcctctcctacaggcagcccagcaaatc
atcgaactccaggaagctgcacaaatcaacgcaggcttacagccaaccaacctgggaagg
aacaacagcctgcacgacatgaagacggtggtgaagacctggaggaaccgactgcccatc
gtgtctgacgacttgtcccactggagcagcatcttcatgtggaggcagcatcattaccag
ggtaaaccgacctggtccggcatgcattcatcatcgattgtaactgcctatgagaatagc
tctcagcatgatcccagttcaaataacgctatgcttggggttcatgcatcagcttcagcg
atcatccagtatggaaaaatcgcccggaaacaaggactggtcaatgtagctctggatata
ttaagtcggattcatactattccaactgttcctatcgtggattgcttccagaagattcga
cagcaagttaaatgctacctccagctggcaggcgtcatgggcaaaaacgagtgcatgcag
ggccttgaagttattgaatctacaaatttaaaatacttcacaaaagagatgacagccgaa
ttttatgcactgaagggaatgttcttggctcagatcaacaagtccgaggaggcaaacaaa
gccttctctgcagctgtgcagatgcacgatgtgctggtgaaagcctgggccatgtggggc
gactacctggagaacatctttgtgaaggagcggcagctgcacctgggcgtgtctgccatc
acctgctacctgcacgcctgccggcatcagaacgagagcaaatcgaggaaatacttagcc
aaggtgctgtggcttttgagttttgatgatgacaaaaacactttggcagatgccgtcgac
aagtactgcattggtgtgccacccatccagtggctggcctggatcccacagctgctcacc
tgcctggttggctcggagggaaagctgctcttgaacctcattagccaggttggacgcgtg
tatccccaagcggtctactttcccatccggaccctgtacctgaccctgaaaatagaacag
cgggaacgctacaagagcgatccagggcccataagagcaacagcacccatgtggcgctgc
agccgaatcatgcacatgcagcgagagctccaccccacccttctgtcttccctggaaggc
atcgtcgatcagatggtctggttcagagaaaattggcatgaagaggttctcaggcagctc
caacagggcctggcgaaatgttactccgtggcgtttgagaaaagtggagcggtgtccgat
gctaaaatcaccccccacactctcaattttgtgaagaagttggtgagcacgtttggggtg
ggcctggagaatgtgtccaacgtctcgaccatgttctccagcgcagcctctgagtctctg
gcccggcgggcgcaggccactgcacaagaccctgtctttcagaagctgaaaggccagttc
acgacggattttgacttcagcgttccaggatccatgaagcttcataatcttatttctaag
ttgaaaaagtggatcaaaatcttggaggccaagaccaagcaactccccaaattcttcctc
atagaggaaaagtgccggttcttgagcaatttctcggcacagacagctgaagtggaaatt
cctggggagtttctgatgccaaagccaacgcattattacatcaagattgcacggttcatg
ccccgggtagagattgtgcagaagcacaacaccgcagcccggcggctgtacatccgggga
cacaatggcaagatctacccatacctcgtcatgaacgacgcctgcctcacagagtcacgg
cgagaggagcgtgtgttgcagctgctgcgtctgctgaacccctgtttggagaagagaaag
gagaccaccaagaggcacttgtttttcacagtgccccgggttgtggcagtttccccacag
atgcgcctcgtggaggacaacccctcttcactttcccttgtggagatctacaagcagcgc
tgcgccaagaagggcatcgagcatgacaaccccatctcccgttactatgaccggctggct
acggtgcaggcgcggggaacccaagccagccaccaggtcctccgcgacatcctcaaggag
gttcagagtaacatggtgccgcgcagcatgctcaaggagtgggcgctgcacaccttcccc
aatgccacggactactggacgttccggaagatgttcaccatccagctggctctgataggc
ttcgcggaattcgtcctgcatttaaatagactcaaccccgagatgttacagatcgctcag
gacactggcaaactgaatgttgcctactttcgatttgacataaacgacgcgactggagac
ctggatgccaaccgtcctgtcccatttcgactcacgcccaacatttctgagtttctgacc
accatcggggtctccggcccgttgacagcgtccatgattgcggtcgcccggtgcttcgcc
cagccaaactttaaggtggatggcattctgaaaacggttctccgggacgagatcattgct
tggcacaaaaaaacacaagaggacacgtcctctcctctctcggccgccgggcagccagag
aacatggacagccagcaactggtgtccctggttcagaaagccgtcaccgccatcatgacc
cgcctgcacaacctcgcccagttcgaaggcggggaaagcaaggtgaacaccctggtggcc
gcggcaaacagcctggacaatctgtgccgcatggaccccgcctggcacccctggctgtga

KEGG   Homo sapiens (human): 10524
Entry
10524             CDS       T01001                                 
Symbol
KAT5, ESA1, HTATIP, HTATIP1, NEDFASB, PLIP, TIP, TIP60, ZC2HC5, cPLA2
Name
(RefSeq) lysine acetyltransferase 5
  KO
K11304  histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05017  Spinocerebellar ataxia
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06440  Transcription
nt06462  Spinocerebellar ataxia
  Element
N00489  HTLV-1 p30II to c-myc-mediated transcription
N00965  RORA-mediated transcription
N00966  Mutation-caused aberrant ATXN1 to RORA-mediated transcription
Disease
H02535  Neurodevelopmental disorder with dysmorphic facies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    10524 (KAT5)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    10524 (KAT5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10524 (KAT5)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10524 (KAT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     10524 (KAT5)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2HisCys zinc factors
    10524 (KAT5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    10524 (KAT5)
   HAT complexes
    TIP60 complex
     10524 (KAT5)
    NuA4 complex
     10524 (KAT5)
SSDB
Motif
Pfam: MOZ_SAS zf-MYST Tudor-knot Acetyltransf_7 Acetyltransf_1
Other DBs
NCBI-GeneID: 10524
NCBI-ProteinID: NP_006379
OMIM: 601409
HGNC: 5275
Ensembl: ENSG00000172977
Pharos: Q92993(Tbio)
UniProt: Q92993 A0A024R597
Structure
LinkDB
Position
11:65712018..65719604
AA seq 513 aa
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacgcat
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccactaag
aacggacttcctgggtcccgtcctggctctccagagagagaggtgccggcctcggcgcag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccagtg
cccagcgagacagccccggcctcggtttttccccagaatggagccgcccgtagggcagtg
gcagcccagccaggacggaagcgaaaatcgaattgtttgggcactgatgaggactcccag
gacagctctgatggaataccgtcagcaccacgcatgactggcagcctggtgtctgatcga
agccacgacgacatcgtcacccggatgaagaacattgagtgcattgagctgggccggcac
cgcctcaagccgtggtacttctccccgtacccacaggaactcaccacattgcctgtcctc
tacctgtgcgagttctgcctcaagtacggccgtagtctcaagtgtcttcagcgtcatttg
accaagtgtgacctacgacatcctccaggcaatgagatttaccgcaagggcaccatctcc
ttctttgagattgatggacgtaagaacaagagttattcccagaacctgtgtcttttggcc
aagtgtttccttgaccataagacactgtactatgacacagaccctttcctcttctacgtc
atgacagagtatgactgtaagggcttccacatcgtgggctacttctccaaggagaaagaa
tcaacggaagactacaatgtggcctgcatcctaaccctgcctccctaccagcgccggggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacaggg
acccctgagaagcccctctcagaccttggcctcctatcctatcgaagctactggtcccag
accatcctggagatcctgatggggctgaagtcggagagcggggagaggccacagatcacc
atcaatgagattagtgaaatcaccagcatcaagaaggaggatgtcatctccactctgcag
tacctcaatctcatcaactactacaagggccagtacatcctcacactgtcagaggacatc
gtggatggccatgagcgggccatgctcaagcggctcctgcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagagggggaagtggtga

DBGET integrated database retrieval system