KEGG   ORTHOLOGY: K19459
Entry
K19459                      KO                                     
Symbol
LMP1
Name
EBV latent membrane protein 1
Pathway
map05169  Epstein-Barr virus infection
map05203  Viral carcinogenesis
Network
nt06114  PI3K signaling (viruses)
nt06119  JAK-STAT signaling (viruses)
nt06122  IFN signaling (viruses)
nt06123  TNF signaling (viruses and bacteria)
nt06140  Transcription (viruses)
nt06165  Epstein-Barr virus (EBV)
  Element
N00224  EBV EBNALP RBP-Jk-mediated transcription
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00226  EBV EBNA3A/3B/3C to RBP-Jk-mediated transcription
N00265  EBV LMP1 to NFKB signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00485  EBV LMP1 to PI3K signaling pathway
N00486  EBV LMP1 to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ko00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    K19459  LMP1; EBV latent membrane protein 1
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    K19459  LMP1; EBV latent membrane protein 1
 09180 Brite Hierarchies
  09185 Viral protein families
   03200 Viral proteins
    K19459  LMP1; EBV latent membrane protein 1
Viral proteins [BR:ko03200]
 dsDNA viruses
  Epstein-Barr virus (Human herpesvirus 4)
   K19459  LMP1; EBV latent membrane protein 1
Genes
VG: 2949777(CeHV15gLMP1) 3783750(LMP-1) 5176215(HHV4tp2_gp80)
Reference
PMID:6086953
  Authors
Fennewald S, van Santen V, Kieff E
  Title
Nucleotide sequence of an mRNA transcribed in latent growth-transforming virus infection indicates that it may encode a membrane protein.
  Journal
J Virol 51:411-9 (1984)
DOI:10.1128/JVI.51.2.411-419.1984
  Sequence
[vg:3783750]
Reference
  Authors
Song YJ, Izumi KM, Shinners NP, Gewurz BE, Kieff E
  Title
IRF7 activation by Epstein-Barr virus latent membrane protein 1 requires localization at activation sites and TRAF6, but not TRAF2 or TRAF3.
  Journal
Proc Natl Acad Sci U S A 105:18448-53 (2008)
DOI:10.1073/pnas.0809933105
  Sequence
[vg:3783750]
LinkDB

KEGG   Homo sapiens (human): 1380
Entry
1380              CDS       T01001                                 
Symbol
CR2, C3DR, CD21, CR, CVID7, SLEB9
Name
(RefSeq) complement C3d receptor 2
  KO
K04012  complement receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
hsa04662  B cell receptor signaling pathway
hsa05169  Epstein-Barr virus infection
Network
nt06136  Complement activation (viruses)
nt06140  Transcription (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01313  Classical pathway of complement activation
Disease
H00080  Systemic lupus erythematosus
H00088  Common variable immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1380 (CR2)
   04610 Complement and coagulation cascades
    1380 (CR2)
   04662 B cell receptor signaling pathway
    1380 (CR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    1380 (CR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1380 (CR2)
CD molecules [BR:hsa04090]
 Proteins
  1380 (CR2)
SSDB
Motif
Pfam: Sushi UL45
Other DBs
NCBI-GeneID: 1380
NCBI-ProteinID: NP_001868
OMIM: 120650
HGNC: 2336
Ensembl: ENSG00000117322
Vega: OTTHUMG00000036307
Pharos: P20023(Tbio)
UniProt: P20023
Structure
LinkDB
Position
1:207454328..207489892
AA seq 1033 aa
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGE
KSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGR
MVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLT
KPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTG
SSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAV
QCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKE
TCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCH
PPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCL
RSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGV
PTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
SQPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQ
WNPPLAVCRSRSLAPVLCGIAAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEA
REVYSVDPYNPAS
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgggcgccgcgggcctgctcggggttttcttggctctcgtcgcaccgggggtcctcggg
atttcttgtggctctcctccgcctatcctaaatggccggattagttattattctaccccc
attgctgttggtaccgtgataaggtacagttgttcaggtaccttccgcctcattggagaa
aaaagtctattatgcataactaaagacaaagtggatggaacctgggataaacctgctcct
aaatgtgaatatttcaataaatattcttcttgccctgagcccatagtaccaggaggatac
aaaattagaggctctacaccctacagacatggtgattctgtgacatttgcctgtaaaacc
aacttctccatgaacggaaacaagtctgtttggtgtcaagcaaataatatgtgggggccg
acacgactaccaacctgtgtaagtgttttccctctcgagtgtccagcacttcctatgatc
cacaatggacatcacacaagtgagaatgttggctccattgctccaggattgtctgtgact
tacagctgtgaatctggttacttgcttgttggagaaaagatcattaactgtttgtcttcg
ggaaaatggagtgctgtcccccccacatgtgaagaggcacgctgtaaatctctaggacga
tttcccaatgggaaggtaaaggagcctccaattctccgggttggtgtaactgcaaacttt
ttctgtgatgaagggtatcgactgcaaggcccaccttctagtcggtgtgtaattgctgga
cagggagttgcttggaccaaaatgccagtatgtgaagaaattttttgcccatcacctccc
cctattctcaatggaagacatataggcaactcactagcaaatgtctcatatggaagcata
gtcacttacacttgtgacccggacccagaggaaggagtgaacttcatccttattggagag
agcactctccgttgtacagttgatagtcagaagactgggacctggagtggccctgcccca
cgctgtgaactttctacttctgcggttcagtgtccacatccccagatcctaagaggccga
atggtatctgggcagaaagatcgatatacctataacgacactgtgatatttgcttgcatg
tttggcttcaccttgaagggcagcaagcaaatccgatgcaatgcccaaggcacatgggag
ccatctgcaccagtctgtgaaaaggaatgccaggcccctcctaacatcctcaatgggcaa
aaggaagatagacacatggtccgctttgaccctggaacatctataaaatatagctgtaac
cctggctatgtgctggtgggagaagaatccatacagtgtacctctgagggggtgtggaca
ccccctgtaccccaatgcaaagtggcagcgtgtgaagctacaggaaggcaactcttgaca
aaaccccagcaccaatttgttagaccagatgtcaactcttcttgtggtgaagggtacaag
ttaagtgggagtgtttatcaggagtgtcaaggcacaattccttggtttatggagattcgt
ctttgtaaagaaatcacctgcccaccaccccctgttatctacaatggggcacacaccggg
agttccttagaagattttccatatggaaccacggtcacttacacatgtaaccctgggcca
gaaagaggagtggaattcagcctcattggagagagcaccatccgttgtacaagcaatgat
caagaaagaggcacctggagtggccctgctcccctgtgtaaactttccctccttgctgtc
cagtgctcacatgtccatattgcaaatggatacaagatatctggcaaggaagccccatat
ttctacaatgacactgtgacattcaagtgttatagtggatttactttgaagggcagtagt
cagattcgttgcaaagctgataacacctgggatcctgaaataccagtttgtgaaaaagaa
acatgccagcatgtgagacagagtcttcaagaacttccagctggttcacgtgtggagcta
gttaatacgtcctgccaagatgggtaccagttgactggacatgcttatcagatgtgtcaa
gatgctgaaaatggaatttggttcaaaaagattccactttgtaaagttattcactgtcac
cctccaccagtgattgtcaatgggaagcacacaggcatgatggcagaaaactttctatat
ggaaatgaagtctcttatgaatgtgaccaaggattctatctcctgggagagaaaaaattg
cagtgcagaagtgattctaaaggacatggatcttggagcgggccttccccacagtgctta
cgatctcctcctgtgactcgctgccctaatccagaagtcaaacatgggtacaagctcaat
aaaacacattctgcatattcccacaatgacatagtgtatgttgactgcaatcctggcttc
atcatgaatggtagtcgcgtgattaggtgtcatactgataacacatgggtgccaggtgtg
ccaacttgtatcaaaaaagccttcatagggtgtccacctccgcctaagacccctaacggg
aaccatactggtggaaacatagctcgattttctcctggaatgtcaatcctgtacagctgt
gaccaaggctacctgctggtgggagaggcactccttctttgcacacatgagggaacctgg
agccaacctgcccctcattgtaaagaggtaaactgtagctcaccagcagatatggatgga
atccagaaagggctggaaccaaggaaaatgtatcagtatggagctgttgtaactctggag
tgtgaagatgggtatatgctggaaggcagtccccagagccagtgccaatcggatcaccaa
tggaaccctcccctggcggtttgcagatcccgttcacttgctcctgtcctttgtggtatt
gctgcaggtttgatacttcttaccttcttgattgtcattaccttatacgtgatatcaaaa
cacagagcacgcaattattatacagatacaagccagaaagaagcttttcatttagaagca
cgagaagtatattctgttgatccatacaacccagccagctga

KEGG   Homo sapiens (human): 3280
Entry
3280              CDS       T01001                                 
Symbol
HES1, HES-1, HHL, HRY, bHLHb39
Name
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa04330  Notch signaling pathway
hsa04950  Maturity onset diabetes of the young
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (viruses)
nt06140  Transcription (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
nt06465  Prion disease
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    3280 (HES1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3280 (HES1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3280 (HES1)
  09162 Cancer: specific types
   05224 Breast cancer
    3280 (HES1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3280 (HES1)
   05165 Human papillomavirus infection
    3280 (HES1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    3280 (HES1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3280 (HES1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3280 (HES1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    3280 (HES1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     3280 (HES1)
SSDB
Motif
Pfam: Hairy_orange HLH MAJIN
Other DBs
NCBI-GeneID: 3280
NCBI-ProteinID: NP_005515
OMIM: 139605
HGNC: 5192
Ensembl: ENSG00000114315
Vega: OTTHUMG00000155984
Pharos: Q14469(Tbio)
UniProt: Q14469
Structure
LinkDB
Position
3:194136148..194138732
AA seq 280 aa
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt   +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatcaaagcct
attatggagaaaagacgaagagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctctgaagaaagatagctcgcggcattccaagctggagaaggcggacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgacggctgcgctg
agcacagacccaagtgtgctggggaagtaccgagccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgcgagggcgttaataccgaggtgcgcactcggctgctc
ggccacctggccaactgcatgacccagatcaatgccatgacctaccccgggcagccgcac
cccgccttgcaggcgccgccaccgcccccaccgggacccggcggcccccagcacgcgccg
ttcgcgccgccgccgccactcgtgcccatccccgggggcgcggcgccccctcccggcggc
gccccctgcaagctgggcagccaggctggagaggcggctaaggtgtttggaggcttccag
gtggtaccggctcccgatggccagtttgctttcctcattcccaacggggccttcgcgcac
agcggccctgtcatccccgtctacaccagcaacagcggcacctccgtgggccccaacgca
gtgtcaccttccagcggcccctcgcttacggcggactccatgtggaggccgtggcggaac
tga

KEGG   Homo sapiens (human): 2208
Entry
2208              CDS       T01001                                 
Symbol
FCER2, BLAST-2, CD23, CD23A, CLEC4J, FCE2, FCErII, IGEBF
Name
(RefSeq) Fc epsilon receptor II
  KO
K06468  low affinity immunoglobulin epsilon Fc receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa05169  Epstein-Barr virus infection
Network
nt06140  Transcription (viruses)
nt06165  Epstein-Barr virus (EBV)
  Element
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
Drug target
Lumiliximab: D06463
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2208 (FCER2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    2208 (FCER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2208 (FCER2)
   04091 Lectins [BR:hsa04091]
    2208 (FCER2)
CD molecules [BR:hsa04090]
 Proteins
  2208 (FCER2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    2208 (FCER2)
SSDB
Motif
Pfam: Lectin_C DUF6779 UPF0242 AIP3 DUF4763 UL45 Golgin_A5 Peptidase_M73 HAUS-augmin3 Exonuc_VII_L FUT8_N_cat
Other DBs
NCBI-GeneID: 2208
NCBI-ProteinID: NP_001207429
OMIM: 151445
HGNC: 3612
Ensembl: ENSG00000104921
Vega: OTTHUMG00000182517
Pharos: P06734(Tchem)
UniProt: P06734
Structure
LinkDB
Position
19:complement(7688776..7702131)
AA seq 321 aa
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA
ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL
SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG
TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV
DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
GPDSRPDPDGRLPTPSAPLHS
NT seq 966 nt   +upstreamnt  +downstreamnt
atggaggaaggtcaatattcagagatcgaggagcttcccaggaggcggtgttgcaggcgt
gggactcagatcgtgctgctggggctggtgaccgccgctctgtgggctgggctgctgact
ctgcttctcctgtggcactgggacaccacacagagtctaaaacagctggaagagagggct
gcccggaacgtctctcaagtttccaagaacttggaaagccaccacggtgaccagatggcg
cagaaatcccagtccacgcagatttcacaggaactggaggaacttcgagctgaacagcag
agattgaaatctcaggacttggagctgtcctggaacctgaacgggcttcaagcagatctg
agcagcttcaagtcccaggaattgaacgagaggaacgaagcttcagatttgctggaaaga
ctccgggaggaggtgacaaagctaaggatggagttgcaggtgtccagcggctttgtgtgc
aacacgtgccctgaaaagtggatcaatttccaacggaagtgctactacttcggcaagggc
accaagcagtgggtccacgcccggtatgcctgtgacgacatggaagggcagctggtcagc
atccacagcccggaggagcaggacttcctgaccaagcatgccagccacaccggctcctgg
attggccttcggaacttggacctgaagggggagtttatctgggtggatgggagccacgtg
gactacagcaactgggctccaggggagcccaccagccggagccagggcgaggactgcgtg
atgatgcggggctccggtcgctggaacgacgccttctgcgaccgtaagctgggcgcctgg
gtgtgcgaccggctggccacatgcacgccgccagccagcgaaggttccgcggagtccatg
ggacctgattcaagaccagaccctgacggccgcctgcccaccccctctgcccctctccac
tcttga

KEGG   Homo sapiens (human): 864
Entry
864               CDS       T01001                                 
Symbol
RUNX3, AML2, CBFA3, PEBP2aC
Name
(RefSeq) RUNX family transcription factor 3
  KO
K09279  runt-related transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05169  Epstein-Barr virus infection
Network
nt06140  Transcription (viruses)
nt06165  Epstein-Barr virus (EBV)
  Element
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    864 (RUNX3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    864 (RUNX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    864 (RUNX3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    864 (RUNX3)
SSDB
Motif
Pfam: Runt RunxI PKD_5
Other DBs
NCBI-GeneID: 864
NCBI-ProteinID: NP_004341
OMIM: 600210
HGNC: 10473
Ensembl: ENSG00000020633
Vega: OTTHUMG00000003316
Pharos: Q13761(Tbio)
UniProt: Q13761
Structure
LinkDB
Position
1:complement(24899511..24965138)
AA seq 415 aa
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
RRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcgtattcccgtagacccaagcaccagccgccgcttcacacctccctccccggccttc
ccctgcggcggcggcggcggcaagatgggcgagaacagcggcgcgctgagcgcgcaggcg
gccgtggggcccggagggcgcgcccggcccgaggtgcgctcgatggtggacgtgctggcg
gaccacgcaggcgagctcgtgcgcaccgacagccccaacttcctctgctccgtgctgccc
tcgcactggcgctgcaacaagacgctgcccgtcgccttcaaggtggtggcattgggggac
gtgccggatggtacggtggtgactgtgatggcaggcaatgacgagaactactccgctgag
ctgcgcaatgcctcggccgtcatgaagaaccaggtggccaggttcaacgaccttcgcttc
gtgggccgcagtgggcgagggaagagtttcaccctgaccatcactgtgttcaccaacccc
acccaagtggcgacctaccaccgagccatcaaggtgaccgtggacggaccccgggagccc
agacggcaccggcagaagctggaggaccagaccaagccgttccctgaccgctttggggac
ctggaacggctgcgcatgcgggtgacaccgagcacacccagcccccgaggctcactcagc
accacaagccacttcagcagccagccccagaccccaatccaaggcacctcggaactgaac
ccattctccgacccccgccagtttgaccgctccttccccacgctgccaaccctcacggag
agccgcttcccagaccccaggatgcattatcccggggccatgtcagctgccttcccctac
agcgccacgccctcgggcacgagcatcagcagcctcagcgtggcgggcatgccggccacc
agccgcttccaccatacctacctcccgccaccctacccgggggccccgcagaaccagagc
gggcccttccaggccaacccgtccccctaccacctctactacgggacatcctctggctcc
taccagttctccatggtggccggcagcagcagtgggggcgaccgctcacctacccgcatg
ctggcctcttgcaccagcagcgctgcctctgtcgccgccggcaacctcatgaaccccagc
ctgggcggccagagtgatggcgtggaggccgacggcagccacagcaactcacccacggcc
ctgagcacgccaggccgcatggatgaggccgtgtggcggccctactga

KEGG   Homo sapiens (human): 4609
Entry
4609              CDS       T01001                                 
Symbol
MYC, MRTL, MYCC, bHLHe39, c-Myc
Name
(RefSeq) MYC proto-oncogene, bHLH transcription factor
  KO
K04377  Myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  JAK-STAT signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05132  Salmonella infection
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05216  Thyroid cancer
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06115  WNT signaling (viruses and bacteria)
nt06130  Cell cycle (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06210  ERK signaling
nt06215  WNT signaling
nt06227  Nuclear receptor signaling
nt06230  Cell cycle
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06267  Small cell lung cancer
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
  Element
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00110  PLZF-RARA fusion to transcriptional activtion
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
N00489  HTLV-1 p30II to c-myc-mediated transcription
N00512  HTLV-1 Tax to c-myc-mediated transcription
N00529  HCV core to RXRA/PPARA-mediated transcription
N00530  HCV core to RXRA/LXRA-mediated transcription
N01124  Salmonella AvrA to beta-catenin signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
Disease
H00001  B-cell acute lymphoblastic leukemia
H00002  T-cell acute lymphoblastic leukemia
H00008  Burkitt lymphoma
H00010  Multiple myeloma
H00013  Small cell lung cancer
H00016  Oral cancer
H00025  Penile cancer
H00027  Ovarian cancer
H00028  Choriocarcinoma
H00036  Osteosarcoma
H00041  Kaposi sarcoma
H00048  Hepatocellular carcinoma
H00055  Laryngeal cancer
H01463  Mycosis fungoides
H01509  Tonsillar cancer
H01554  Fallopian tube cancer
H01667  Medulloblastoma
H02434  Diffuse large B-cell lymphoma, not otherwise specified
Drug target
Omacetaxine mepesuccinate: D08956<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4609 (MYC)
   04012 ErbB signaling pathway
    4609 (MYC)
   04310 Wnt signaling pathway
    4609 (MYC)
   04350 TGF-beta signaling pathway
    4609 (MYC)
   04390 Hippo signaling pathway
    4609 (MYC)
   04630 JAK-STAT signaling pathway
    4609 (MYC)
   04151 PI3K-Akt signaling pathway
    4609 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4609 (MYC)
   04218 Cellular senescence
    4609 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4609 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4609 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4609 (MYC)
   05202 Transcriptional misregulation in cancer
    4609 (MYC)
   05206 MicroRNAs in cancer
    4609 (MYC)
   05205 Proteoglycans in cancer
    4609 (MYC)
   05207 Chemical carcinogenesis - receptor activation
    4609 (MYC)
   05230 Central carbon metabolism in cancer
    4609 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    4609 (MYC)
   05225 Hepatocellular carcinoma
    4609 (MYC)
   05226 Gastric cancer
    4609 (MYC)
   05216 Thyroid cancer
    4609 (MYC)
   05221 Acute myeloid leukemia
    4609 (MYC)
   05220 Chronic myeloid leukemia
    4609 (MYC)
   05219 Bladder cancer
    4609 (MYC)
   05213 Endometrial cancer
    4609 (MYC)
   05224 Breast cancer
    4609 (MYC)
   05222 Small cell lung cancer
    4609 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4609 (MYC)
   05161 Hepatitis B
    4609 (MYC)
   05160 Hepatitis C
    4609 (MYC)
   05163 Human cytomegalovirus infection
    4609 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4609 (MYC)
   05169 Epstein-Barr virus infection
    4609 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    4609 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4609 (MYC)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4609 (MYC)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4609 (MYC)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4609 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 4609
NCBI-ProteinID: NP_002458
OMIM: 190080
HGNC: 7553
Ensembl: ENSG00000136997
Vega: OTTHUMG00000128475
Pharos: P01106(Tbio)
UniProt: P01106
Structure
LinkDB
Position
8:127735434..127742951
AA seq 454 aa
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
NT seq 1365 nt   +upstreamnt  +downstreamnt
ctggatttttttcgggtagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacacccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcgcctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgtcaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

DBGET integrated database retrieval system