KEGG   Homo sapiens (human): 3559
Entry
3559              CDS       T01001                                 
Symbol
IL2RA, CD25, IDDM10, IL2R, IMD41, TCGFR, p55
Name
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01268  IL2 to IL2R signaling
Disease
H00408  Type 1 diabetes mellitus
Drug target
Aldesleukin: D00748<US>
Antithymocyte immunoglobulin (rabbit): D09190<JP/US>
Basiliximab: D03058<JP/US>
Camidanlumab: D11324
Camidanlumab tesirine: D11325
Celmoleukin: D02743
Daclizumab: D03639
Denileukin diftitox: D03682<JP>
Melredableukin alfa: D12386
Nemvaleukin alfa: D12371
Rezpegaldesleukin: D12328
Teceleukin: D02749<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3559 (IL2RA)
   04151 PI3K-Akt signaling pathway
    3559 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3559 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3559 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3559 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3559 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    3559 (IL2RA)
   04659 Th17 cell differentiation
    3559 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3559 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3559 (IL2RA)
   05162 Measles
    3559 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3559 (IL2RA)
   04090 CD molecules [BR:hsa04090]
    3559 (IL2RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3559 (IL2RA)
CD molecules [BR:hsa04090]
 Proteins
  3559 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 3559
NCBI-ProteinID: NP_000408
OMIM: 147730
HGNC: 6008
Ensembl: ENSG00000134460
Pharos: P01589(Tclin)
UniProt: P01589
Structure
LinkDB
Position
10:complement(6010689..6062367)
AA seq 272 aa
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccgccagagatcccacacgccacattcaaagccatggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgccactcggaacacaacgaaacaagtgacacctcaacctgaagaa
cagaaagaaaggaaaaccacagaaatgcaaagtccaatgcagccagtggaccaagcgagc
cttccaggtcactgcagggaacctccaccatgggaaaatgaagccacagagagaatttat
catttcgtggtggggcagatggtttattatcagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccacgggaagacaaggtggacccagccc
cagctcatatgcacaggtgaaatggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccgtcctgagagtgagacttcctgcctcgtcacaacaacagatttt
caaatacagacagaaatggctgcaaccatggagacgtccatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcagcggagacagaggaagagtagaagaacaatctag

KEGG   Homo sapiens (human): 3560
Entry
3560              CDS       T01001                                 
Symbol
IL2RB, CD122, IL15RB, IMD63, P70-75
Name
(RefSeq) interleukin 2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00137  EWSR1-WT1 fusion to transcriptional activation
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
N01268  IL2 to IL2R signaling
Disease
H02525  Disorders of innate immunity
Drug target
Aldesleukin: D00748<US>
Bempegaldesleukin: D11669
Celmoleukin: D02743
Rezpegaldesleukin: D12328
Teceleukin: D02749<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3560 (IL2RB)
   04151 PI3K-Akt signaling pathway
    3560 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3560 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3560 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3560 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3560 (IL2RB)
   04659 Th17 cell differentiation
    3560 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3560 (IL2RB)
   05202 Transcriptional misregulation in cancer
    3560 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3560 (IL2RB)
   05162 Measles
    3560 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3560 (IL2RB)
   04090 CD molecules [BR:hsa04090]
    3560 (IL2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3560 (IL2RB)
CD molecules [BR:hsa04090]
 Proteins
  3560 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 3560
NCBI-ProteinID: NP_000869
OMIM: 146710
HGNC: 6009
Ensembl: ENSG00000100385
Pharos: P14784(Tclin)
UniProt: P14784
Structure
LinkDB
Position
22:complement(37125838..37175118)
AA seq 551 aa
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggcggcccctgctctgtcctggcgtctgcccctcctcatcctcctcctgcccctggct
acctcttgggcatctgcagcggtgaatggcacttcccagttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggcggtggaaccaaacctgtgagctgctccccgtgagt
caagcatcctgggcctgcaacctgatcctcggagccccagattctcagaaactgaccaca
gttgacatcgtcaccctgagggtgctgtgccgtgagggggtgcgatggagggtgatggcc
atccaggacttcaagccctttgagaaccttcgcctgatggcccccatctccctccaagtt
gtccacgtggagacccacagatgcaacataagctgggaaatctcccaagcctcccactac
tttgaaagacacctggagttcgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgctgactctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcttttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
aacaccccagacccctcgaagttcttttcccagctgagctcagagcatggaggagacgtc
cagaagtggctctcttcgcccttcccctcatcgtccttcagccctggcggcctggcacct
gagatctcgccactagaagtgctggagagggacaaggtgacgcagctgctcctgcagcag
gacaaggtgcctgagcccgcatccttaagcagcaaccactcgctgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttacgacccctactcagaggaagaccctgatgagggtgtggccggggcaccc
acagggtcttccccccaacccctgcagcctctgtcaggggaggacgacgcctactgcacc
ttcccctccagggatgacctgctgctcttctcccccagtctcctcggtggccccagcccc
ccaagcactgcccctgggggcagtggggccggtgaagagaggatgcccccttctttgcaa
gaaagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccaccccctgagctggtgctgcgagaggctggggaggaggtc
cctgacgctggccccagggagggagtcagtttcccctggtccaggcctcctgggcagggg
gagttcagggcccttaatgctcgcctgcccctgaacactgatgcctacttgtccctccaa
gaactccagggtcaggacccaactcacttggtgtag

KEGG   Homo sapiens (human): 3561
Entry
3561              CDS       T01001                                 
Symbol
IL2RG, CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Name
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
hsa05340  Primary immunodeficiency
Network
nt06119  JAK-STAT signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
N01268  IL2 to IL2R signaling
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Aldesleukin: D00748<US>
Celmoleukin: D02743
Rezpegaldesleukin: D12328
Teceleukin: D02749<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3561 (IL2RG)
   04151 PI3K-Akt signaling pathway
    3561 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3561 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3561 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3561 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3561 (IL2RG)
   04659 Th17 cell differentiation
    3561 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3561 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3561 (IL2RG)
   05162 Measles
    3561 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    3561 (IL2RG)
   05340 Primary immunodeficiency
    3561 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3561 (IL2RG)
   04090 CD molecules [BR:hsa04090]
    3561 (IL2RG)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3561 (IL2RG)
CD molecules [BR:hsa04090]
 Proteins
  3561 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 3561
NCBI-ProteinID: NP_000197
OMIM: 308380
HGNC: 6010
Ensembl: ENSG00000147168
Pharos: P31785(Tclin)
UniProt: P31785
Structure
LinkDB
Position
X:complement(71107404..71111577)
AA seq 369 aa
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcacatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgaccactatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctctgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gcccttggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctaaagcctgaaacctga

KEGG   Homo sapiens (human): 3563
Entry
3563              CDS       T01001                                 
Symbol
IL3RA, CD123, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Name
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Daniplestim: D03645
Flotetuzumab: D11306
Leridistim: D04695
Milodistim: D05036
Muplestim: D05090
Pivekimab: D12307
Pivekimab sunirine: D12308
Tagraxofusp: D11358<US>
Vibecotamab: D11841
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3563 (IL3RA)
   04151 PI3K-Akt signaling pathway
    3563 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3563 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3563 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3563 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3563 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3563 (IL3RA)
   04090 CD molecules [BR:hsa04090]
    3563 (IL3RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3563 (IL3RA)
CD molecules [BR:hsa04090]
 Proteins
  3563 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N LIFR_N EpoR_lig-bind Tissue_fac DUF4812 Y_Y_Y
Other DBs
NCBI-GeneID: 3563
NCBI-ProteinID: NP_002174
OMIM: 308385 430000
HGNC: 6012
Ensembl: ENSG00000185291
Pharos: P26951(Tbio)
UniProt: P26951
Structure
LinkDB
Position
X:1336785..1382689, Y:1336785..1382689
AA seq 378 aa
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtcctcctttggctcacgctgctcctgatcgccctgccctgtctcctgcaaacgaag
gaagatccaaacccaccaatcacgaacctaaggatgaaagcaaaggctcagcagttgacc
tgggaccttaacagaaatgtgaccgatatcgagtgtgttaaagacgccgactattctatg
ccggcagtgaacaatagctattgccagtttggagcaatttccttatgtgaagtgaccaac
tacaccgtccgagtggccaacccaccattctccacgtggatcctcttccctgagaacagt
gggaagccttgggcaggtgcggagaatctgacctgctggattcatgacgtggatttcttg
agctgcagctgggcggtaggcccgggggcccccgcggacgtccagtacgacctgtacttg
aacgttgccaacaggcgtcaacagtacgagtgtcttcactacaaaacggatgctcaggga
acacgtatcgggtgtcgtttcgatgacatctctcgactctccagcggttctcaaagttcc
cacatcctggtgcggggcaggagcgcagccttcggtatcccctgcacagataagtttgtc
gtcttttcacagattgagatattaactccacccaacatgactgcaaagtgtaataagaca
cattcctttatgcactggaaaatgagaagtcatttcaatcgcaaatttcgctatgagctt
cagatacaaaagagaatgcagcctgtaatcacagaacaggtcagagacagaacctccttc
cagctactcaatcctggaacgtacacagtacaaataagagcccgggaaagagtgtatgaa
ttcttgagcgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggcgcaaac
acacgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccctggtctgt
gtcttcgtgatctgcagaaggtatctggtgatgcagagactctttccccgcatccctcac
atgaaagaccccatcggtgacagcttccaaaacgacaagctggtggtctgggaggcgggc
aaagccggcctggaggagtgtctggtgactgaagtacaggtcgtgcagaaaacttga

KEGG   Homo sapiens (human): 3566
Entry
3566              CDS       T01001                                 
Symbol
IL4R, CD124, IL-4RA, IL4RA
Name
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00079  Asthma
H01358  Atopic dermatitis
H01563  HIV infection
Drug target
Dupilumab: D10354<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3566 (IL4R)
   04151 PI3K-Akt signaling pathway
    3566 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3566 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3566 (IL4R)
   04658 Th1 and Th2 cell differentiation
    3566 (IL4R)
   04659 Th17 cell differentiation
    3566 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3566 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    3566 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3566 (IL4R)
   04090 CD molecules [BR:hsa04090]
    3566 (IL4R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3566 (IL4R)
CD molecules [BR:hsa04090]
 Proteins
  3566 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 3566
NCBI-ProteinID: NP_000409
OMIM: 147781
HGNC: 6015
Ensembl: ENSG00000077238
Pharos: P24394(Tbio)
UniProt: P24394
Structure
LinkDB
Position
16:27313756..27364778
AA seq 825 aa
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT
TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE
AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcttgcaggagcccacctgcgtctccgactacatgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaagcccacacgtgtatccctgagaacaacgga
ggcgcggggtgcgtgtgccacctgctcatggatgacgtggtcagtgcggataactataca
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctgacagttcacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccctccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcagtgctataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcgtttcc
tgcattgtcatcctggccgtctgcctgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctcaggggtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaaagg
gatgaagatcctcacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccagtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgtgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggtagaggaagaa
aaagggagcttctgtgcatcgcctgagagcagcagggatgacttccaggagggaagggag
ggcattgtggcccggctaacagagagcctgttcctggacctgctcggagaggagaatggg
ggcttttgccagcaggacatgggggagtcatgccttcttccaccttcgggaagtacgagt
gctcacatgccctgggatgagttcccaagtgcagggcccaaggaggcacctccctggggc
aaggagcagcctctccacctggagccaagtcctcctgccagcccgacccagagtccagac
aacctgacttgcacagagacgcccctcgtcatcgcaggcaaccctgcttaccgcagcttc
agcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccactgctggcc
agacacctggaggaagtagaacccgagatgccctgtgtcccccagctctctgagccaacc
actgtgccccaacctgagccagaaacctgggagcagatcctccgccgaaatgtcctccag
catggggcagctgcagcccccgtctcggcccccaccagtggctatcaggagtttgtacat
gcggtggagcagggtggcacccaggccagtgcggtggtgggcttgggtcccccaggagag
gctggttacaaggccttctcaagcctgcttgccagcagtgctgtgtccccagagaaatgt
gggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcctggc
tgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcgcagtccgcagagctcacatctcccaagcagctccccagagcacctgggtctg
gagccgggggaaaaggtagaggacatgccaaagcccccacttccccaggagcaggccaca
gacccccttgtggacagcctgggcagtggcattgtctactcagcccttacctgccacctg
tgcggccacctgaaacagtgtcatggccaggaggatggtggccagacccctgtcatggcc
agtccttgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctgagg
gccccagacccctctccaggtggggttccactggaggccagtctgtgtccggcctccctg
gcaccctcgggcatctcagagaagagtaaatcctcatcatccttccatcctgcccctggc
aatgctcagagctcaagccagacccccaaaatcgtgaactttgtctccgtgggacccaca
tacatgagggtctcttag

KEGG   Homo sapiens (human): 1439
Entry
1439              CDS       T01001                                 
Symbol
CSF2RB, CD131, CDw131, IL3RB, IL5RB, SMDP5, betaGMR
Name
(RefSeq) colony stimulating factor 2 receptor subunit beta
  KO
K04738  cytokine receptor common subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04210  Apoptosis
hsa04630  JAK-STAT signaling pathway
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01122  Congenital pulmonary alveolar proteinosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1439 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1439 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    1439 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1439 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1439 (CSF2RB)
   04090 CD molecules [BR:hsa04090]
    1439 (CSF2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   1439 (CSF2RB)
CD molecules [BR:hsa04090]
 Proteins
  1439 (CSF2RB)
SSDB
Motif
Pfam: fn3 IL6Ra-bind IL4Ra_N EpoR_lig-bind Tissue_fac IL2RB_N1 Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 1439
NCBI-ProteinID: NP_000386
OMIM: 138981
HGNC: 2436
Ensembl: ENSG00000100368
Pharos: P32927(Tclin)
UniProt: P32927 Q6NSJ8
Structure
LinkDB
Position
22:36913628..36940439
AA seq 897 aa
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
NT seq 2694 nt   +upstreamnt  +downstreamnt
atggtgctggcccaggggctgctctccatggccctgctggccctgtgctgggagcgcagc
ctggcaggggcagaagaaaccatcccgctgcagaccctgcgctgctacaacgactacacc
agccacatcacctgcaggtgggcagacacccaggatgcccagcggctcgtcaacgtgacc
ctcattcgccgggtgaatgaggacctcctggagccagtgtcctgtgacctcagtgatgac
atgccctggtcagcctgcccccatccccgctgcgtgcccaggagatgtgtcattccctgc
cagagttttgtcgtcactgacgttgactacttctcattccaaccagacaggcctctgggc
acccggctcaccgtcactctgacccagcatgtccagcctcctgagcccagggacctgcag
atcagcaccgaccaggaccacttcctgctgacctggagtgtggcccttgggagtccccag
agccactggttgtccccaggggatctggagtttgaggtggtctacaagcggcttcaggac
tcttgggaggacgcagccatcctcctctccaacacctcccaggccaccctggggccagag
cacctcatgcccagcagcacctacgtggcccgagtacggacccgcctggccccaggttct
cggctctcaggacgtcccagcaagtggagcccagaggtttgctgggactcccagccaggg
gatgaggcccagccccagaacctggagtgcttctttgacggggccgccgtgctcagctgc
tcctgggaggtgaggaaggaggtggccagctcggtctcctttggcctattctacaagccc
agcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagcctc
cacaccaggcaccactgccagattcccgtgcccgaccccgcgacccacggccaatacatc
gtctctgttcagccaaggagggcagagaaacacataaagagctcagtgaacatccagatg
gcccctccatccctcaacgtgaccaaggatggagacagctacagcctgcgctgggaaaca
atgaaaatgcgatacgaacacatagaccacacatttgagatccagtacaggaaagacacg
gccacgtggaaggacagcaagaccgagaccctccagaacgcccacagcatggccctgcca
gccctggagccctccaccaggtactgggccagggtgagggtcaggacctcccgcaccggc
tacaacgggatctggagcgagtggagtgaggcgcgctcctgggacaccgagtcggtgctg
cctatgtgggtgctggccctcatcgtgatcttcctcaccatcgctgtgctcctggccctc
cgcttctgtggcatctacgggtacaggctgcgcagaaagtgggaggagaagatccccaac
cccagcaagagccacctgttccagaacgggagcgcagagctttggcccccaggcagcatg
tcggccttcactagcgggagtcccccacaccaggggccgtggggcagccgcttccctgag
ctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccatagag
gaccccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagat
ctacccacagagcagccccccagcccccagccaggcccgcctgccgcctcccacacacct
gagaaacaggcttccagctttgacttcaatgggccctacctggggccgccccacagccgc
tccctacctgacatcctgggccagccggagcccccacaggagggtgggagccagaagtcc
ccacctccagggtccctggagtacctgtgtctgcctgctggggggcaggtgcaactggtc
cctctggcccaggcgatgggaccaggacaggccgtggaagtggagagaaggccgagccag
ggggctgcagggagtccctccctggagtccgggggaggccctgcccctcctgctcttggg
ccaagggtgggaggacaggaccaaaaggacagccctgtggctatacccatgagctctggg
gacactgaggaccctggagtggcctctggttatgtctcctctgcagacctggtattcacc
ccaaactcaggggcctcgtctgtctccctagttccctctctgggcctcccctcagaccag
acccccagcttatgtcctgggctggccagtggaccccctggagccccaggccctgtgaag
tcagggtttgagggctatgtggagctccctccaattgagggccggtcccccaggtcacca
aggaacaatcctgtcccccctgaggccaaaagccctgtcctgaacccaggggaacgcccg
gcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaagtgggc
gactattgcttcctccccggcctggggcccggccctctctcgctccggagtaaaccttct
tccccgggacccggtcctgagatcaagaacctagaccaggcttttcaagtcaagaagccc
ccaggccaggctgtgccccaggtgcccgtcattcagctcttcaaagccctgaagcagcag
gactacctgtctctgcccccttgggaggtcaacaagcctggggaggtgtgttga

KEGG   Homo sapiens (human): 3568
Entry
3568              CDS       T01001                                 
Symbol
IL5RA, CD125, CDw125, HSIL5R3, IL5R
Name
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Benralizumab: D09874<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3568 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3568 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3568 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3568 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3568 (IL5RA)
   04090 CD molecules [BR:hsa04090]
    3568 (IL5RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3568 (IL5RA)
CD molecules [BR:hsa04090]
 Proteins
  3568 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 3568
NCBI-ProteinID: NP_000555
OMIM: 147851
HGNC: 6017
Ensembl: ENSG00000091181
Pharos: Q01344(Tbio)
UniProt: Q01344 A0A024R2E8
Structure
LinkDB
Position
3:complement(3066324..3110374)
AA seq 420 aa
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgatcatcgtggcgcatgtattactcatccttttgggggccactgagatactgcaagct
gacttacttcctgatgaaaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacaatggaaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaacgctccaaaagaagatgactatgaaaccaga
atcactgaaagcaaatgtgtaaccatcctccacaaaggcttttcagcaagtgtgcggacc
atcctgcagaacgaccactcactactggccagcagctgggcttctgctgaacttcatgcc
ccaccagggtctcctggaacctcaattgtgaatttaacttgcaccacaaacactacagaa
gacaattattcacgtttaaggtcataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagacacactggggagaaatatcgcatgctggtttcccagg
acttttatcctcagcaaagggcgtgactggcttgcggtgcttgttaacggctccagcaag
cactctgctatcaggccctttgatcagctgtttgcccttcacgccattgatcaaataaat
cctccactgaatgtcacagcagagattgaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcttttccaatccattgctttgattatgaagtaaaaatacacaatacaagg
aatggatatttgcagatagaaaaattgatgaccaatgcattcatctcaataattgatgat
ctttctaagtacgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcaggg
ctctggagtgagtggagccaacctatttatgtgggaaatgatgaacacaagcccttgaga
gagtggtttgtcattgtgattatggcaaccatctgcttcatcttgttaattctctcgctt
atctgtaaaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
aatatcaaagatctctttgtaaccactaactatgagaaagctgggtccagtgagacggaa
attgaagtcatctgttatatagagaagcctggagttgagaccctggaggattctgtgttt
tga

KEGG   Homo sapiens (human): 3570
Entry
3570              CDS       T01001                                 
Symbol
IL6R, CD126, HIES5, IL-1Ra, IL-6R, IL-6R-1, IL-6RA, IL6Q, IL6QTL, IL6RA, IL6RQ, gp80
Name
(RefSeq) interleukin 6 receptor
  KO
K05055  interleukin 6 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04659  Th17 cell differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa05163  Human cytomegalovirus infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01266  IL6 to IL6R signaling
N01267  KSHV vIL6 to IL6R signaling
Disease
H01968  Hyper-IgE syndrome
Drug target
Sarilumab: D10161<JP/US>
Satralizumab: D11079<JP/US>
Tocilizumab: D02596<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3570 (IL6R)
   04066 HIF-1 signaling pathway
    3570 (IL6R)
   04151 PI3K-Akt signaling pathway
    3570 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3570 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3570 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3570 (IL6R)
   04659 Th17 cell differentiation
    3570 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3570 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    3570 (IL6R)
   05163 Human cytomegalovirus infection
    3570 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    3570 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3570 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3570 (IL6R)
   04090 CD molecules [BR:hsa04090]
    3570 (IL6R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3570 (IL6R)
CD molecules [BR:hsa04090]
 Proteins
  3570 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_2 fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 3570
NCBI-ProteinID: NP_000556
OMIM: 147880
HGNC: 6019
Ensembl: ENSG00000160712
Pharos: P08887(Tclin)
UniProt: P08887 A0N0L5
Structure
LinkDB
Position
1:154405343..154469450
AA seq 468 aa
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgccctgctggccgcgccgggagcggcgctg
gccccaaggcgctgccctgcgcaggaggtggcgagaggcgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccgggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccaccccagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccacgactctggaaactattcatgctaccgggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaatgttgtttgtgagtggggtcctcggagcacccca
tccctgacgacaaaggctgtgctcttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcccaggagtcccagaagttctcctgccagttagcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgtcgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacgccttggacagaatccaggagt
cctccagctgagaacgaggtgtccacccccatgcaggcacttactactaataaagacgat
gataatattctcttcagagattctgcaaatgcgacaagcctcccagtgcaagattcttct
tcagtaccactgcccacattcctggttgctggagggagcctggccttcggaacgctcctc
tgcattgccattgttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggc
aagacaagcatgcatccgccgtactctttggggcagctggtcccggagaggcctcgaccc
accccagtgcttgttcctctcatctccccaccggtgtcccccagcagcctggggtctgac
aatacctcgagccacaaccgaccagatgccagggacccacggagcccttatgacatcagc
aatacagactacttcttccccagatag

KEGG   Homo sapiens (human): 3572
Entry
3572              CDS       T01001                                 
Symbol
IL6ST, CD130, CDW130, GP130, HIES4, HIES4A, HIES4B, IL-6RB, IMD94, STWS2, sGP130
Name
(RefSeq) interleukin 6 cytokine family signal transducer
  KO
K05060  interleukin 6 signal transducer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
Network
nt06119  JAK-STAT signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00181  KSHV vIL-6 to Jak-STAT signaling pathway
N01266  IL6 to IL6R signaling
N01267  KSHV vIL6 to IL6R signaling
Disease
H01968  Hyper-IgE syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3572 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3572 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3572 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3572 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3572 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3572 (IL6ST)
   05203 Viral carcinogenesis
    3572 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    3572 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3572 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3572 (IL6ST)
   04090 CD molecules [BR:hsa04090]
    3572 (IL6ST)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3572 (IL6ST)
CD molecules [BR:hsa04090]
 Proteins
  3572 (IL6ST)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind fn3_2 Pur_ac_phosph_N Interfer-bind DCP1 ObR_Ig
Other DBs
NCBI-GeneID: 3572
NCBI-ProteinID: NP_002175
OMIM: 600694
HGNC: 6021
Ensembl: ENSG00000134352
Pharos: P40189(Tclin)
UniProt: P40189 Q17RA0
Structure
LinkDB
Position
5:complement(55935095..55994963)
AA seq 918 aa
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacgttgcagacttggctagtgcaagccttgtttattttcctcaccactgaatct
acaggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaattacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcatccagtgtcacctttacagatatagcttcattaaatattcag
ctcacttgcaacattcttacattcggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaacgaggggaag
aaaatgaggtgtgagtgggatggtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataatactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattcctcctgaagacacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggattcgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaagtgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
actcaaggctacagaactgtacaactcgtgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattac
acagttaatgccacaaaactgacagtaaatctcacaaatgatcgctatctagcaacccta
acagtaagaaatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtgac
tttcaagctactcaccctgtaatggatcttaaagcattccccaaagataacatgctttgg
gtggaatggactactccaagggaatctgtaaagaaatatatacttgagtggtgtgtgtta
tcagataaagcaccctgtatcacagactggcaacaagaagatggtaccgtgcatcgcacc
tatttaagagggaacttagcagagagcaaatgctatttgataacagttactccagtatat
gctgatggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaaaaaagtagggaaaaacgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcc
tctttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtggg
aaggatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagcc
atagtcgtgcctgtttgcttagcattcctattgacaactcttctgggagtgctgttctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacactcctccaaggcacaattttaattcaaaagat
caaatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgac
aaaaagccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaat
actgaaggacacagcagtggtattggggggtcttcatgcatgtcatcttctaggccaagc
atttctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattct
accgtggtacacagtggctacagacaccaagttccgtcagtccaagtcttctcaagatcc
gagtctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagat
catgtagatggcggtgatggtattttgcccaggcaacagtacttcaaacagaactgcagt
cagcatgaatccagtccagatatttcacattttgaaaggtcaaagcaagtttcatcagtc
aatgaggaagattttgttagacttaaacagcagatttcagatcatatttcacaatcctgt
ggatctgggcaaatgaaaatgtttcaggaagtttctgcagcagatgcttttggtccaggt
actgagggacaagtagaaagatttgaaacagttggcatggaggctgcgactgatgaaggc
atgcctaaaagttacttaccacagactgtacggcaaggcggctacatgcctcagtga

KEGG   Homo sapiens (human): 3575
Entry
3575              CDS       T01001                                 
Symbol
IL7R, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA, IMD104
Name
(RefSeq) interleukin 7 receptor
  KO
K05072  interleukin 7 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05340  Primary immunodeficiency
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3575 (IL7R)
   04068 FoxO signaling pathway
    3575 (IL7R)
   04151 PI3K-Akt signaling pathway
    3575 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3575 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3575 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3575 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    3575 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3575 (IL7R)
   04090 CD molecules [BR:hsa04090]
    3575 (IL7R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3575 (IL7R)
CD molecules [BR:hsa04090]
 Proteins
  3575 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 3575
NCBI-ProteinID: NP_002176
OMIM: 146661
HGNC: 6024
Ensembl: ENSG00000168685
Pharos: P16871(Tbio)
UniProt: P16871
Structure
LinkDB
Position
5:35856891..35879603
AA seq 459 aa
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgctcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcgcagcactcactgacctgtgcttttgag
gacccagatgtcaacatcaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgaatttcaggaaactacaagagatatatttcatcgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggagaaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctgagtgtcgtctatcgg
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaggatgaaaacaaatggacgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaagctccaaccggcagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttattacttcagaactccagagatcaataatagctcaggggagatggatcct
atcttactaaccatcagcattttgagttttttctctgtcgctctgttggtcatcttggcc
tgtgtgttatggaaaaaaaggattaagcctatcgtatggcccagtctccccgatcataag
aagactctggaacatctttgtaagaaaccaagaaaaaatttaaatgtgagtttcaatcct
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatacgtttcctcagcaactagaagaatctgagaagcagaggctt
ggaggggatgtgcagagccccaactgcccatctgaggatgtagtcatcactccagaaagc
tttggaagagattcatccctcacatgcctggctgggaatgtcagtgcatgtgacgcccct
attctctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcacgctgccccctccattttct
ctccaatctggaatcctgacattgaacccagttgctcagggtcagcccattcttacttcc
ctgggatcaaatcaagaagaagcatatgtcaccatgtccagcttctaccaaaaccagtga

DBGET integrated database retrieval system