KEGG   Homo sapiens (human): 1128
Entry
1128              CDS       T01001                                 
Symbol
CHRM1, HM1, M1, M1R
Name
(RefSeq) cholinergic receptor muscarinic 1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04725  Cholinergic synapse
hsa04810  Regulation of actin cytoskeleton
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
  Element
N01000  mAChR-Ca2+ -apoptotic pathway
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
Drug target
Aceclidine: D02750
Acetylcholine (DG01133): D00999<JP/US>
Aclatonium (DG01291): D01955
Aclidinium bromide: D08837<JP/US>
Alvameline maleate: D02876
Anisotropine methylbromide: D00232
Atropine (DG00052): D00113<US> D02069<JP/US>
Atropine oxide (DG01243): D03011 D07477
Batefenterol (DG01627): D10545 D10546
Benapryzine hydrochloride: D03076
Benzatropine (DG00859): D00778<US> D07511
Benzetimide (DG01301): D03087 D07513
Benzilone: D03088
Bethanechol (DG00991): D01000<JP/US>
Bevonium: D01532
Biperiden (DG00852): D00779 D02246<JP> D02247<JP>
Blarcamesine (DG03048): D11383 D11549
Bornaprine: D07302
Butropium bromide: D01491<JP>
Butylscopolamine: D01451<JP>
Carbachol: D00524<US>
Carpronium (DG01289): D01175<JP> D09752<JP>
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Choline alfoscerate: D07349
Cimetropium bromide: D07099
Clidinium bromide: D00716
Cyclopentolate (DG01141): D01002<JP/US> D07759
Darotropium bromide: D09402
Dexetimide (DG00856): D03711 D07804
Dicycloverine (DG00032): D00717<US> D07820
Diethazine (DG01921): D02603 D07823
Difemerine: D07079
Dihexyverine (DG00033): D03824 D07821
Diphenidol (DG02880): D01318<JP> D03858 D03859
Diphenylpiperidinomethyldioxolan iodide: D01600
Diponium bromide: D01463
Elantrine: D03970
Elucaine: D03979
Esoxybutynin chloride: D04057
Etomidoline: D01359
Etybenzatropine: D04087
Eucatropine hydrochloride: D04116
Fenpiverinium: D07070
Fentonium: D07951
Flutropium bromide: D02417
Glycopyrronium (DG02467): D10939<JP/US>
Heteronium bromide: D04434
Homatropine (DG01142): D01004
Homatropine methylbromide: D02070
Hyoscyamine (DG00053): D00147 D00719 D01648 D04479
Imidafenacin: D06273<JP>
Ipratropium bromide: D02212<JP/US>
Mazaticol (DG00857): D03264<JP> D08157
Mebeverine (DG00030): D04868 D08160
Mepenzolate (DG00040): D00720<JP>
Methacholine: D04970<JP/US>
Methantheline (DG00036): D00721
Methscopolamine bromide: D00715<US>
Methylatropine (DG01242): D01077 D03814
Methylbenactyzium bromide: D01315
Methylscopolamine: D01976<JP>
Metixene (DG00853): D01871 D08209
Metoquizine: D05012
Milameline hydrochloride: D05035
Otilonium bromide: D07083
Oxapium iodide: D01815
Oxitropium bromide: D01946
Oxybutynin (DG00478): D00465<US> D00722<JP/US>
Oxyphencyclimine (DG00029): D01006 D08325
Oxyphenonium: D06877
Parapenzolate bromide: D05360
Pentapiperium methylsulfate: D05418
Penthienate: D07081
Phencarbamide: D05452
Phenglutarimide: D07301
Pipenzolate: D07084
Piperidolate (DG00034): D01165<JP> D08382
Pipethanate (DG01255): D01521 D08384
Pipethanate ethobromide: D01987
Pirenzepine (DG00026): D01297 D05276<JP> D08389
Piroheptine (DG01272): D01231<JP> D08395
Poldine: D05535
Pridinol (DG00774): D02064<JP> D08418 D08419
Prifinium bromide: D01377
Procyclidine (DG00854): D00782 D08425
Profenamine (DG00855): D01118 D03276 D08426
Propantheline (DG00035): D00481<JP/US>
Propenzolate hydrochloride: D05628
Propiverine (DG00479): D01007<JP> D08441
Rapacuronium bromide: D05703
Rocuronium bromide: D00765<JP/US>
Sabcomeline hydrochloride: D05779
Scopolamine (DG00065): D00138<US> D02071<JP>
Talsaclidine fumarate: D06000
Tazomeline citrate: D06015
Telenzepine hydrochloride hydrate: D11098
Tematropium methylsulfate: D06061
Tiemonium (DG01254): D08595
Tiemonium iodide: D01201
Timepidium bromide (DG00041): D02535<JP>
Tofenacin hydrochloride: D06175
Toquizine: D06192
Triampyzine sulfate: D06217
Tridihexethyl (DG00037): D00723
Trihexyphenidyl (DG00851): D00787<JP/US> D08638
Tropatepine (DG00858): D07303 D08653
Tropicamide: D00397<JP/US>
Umeclidinium (DG01253): D10180
Umeclidinium bromide: D10181<JP/US>
Valethamate: D01538
Xanomeline (DG01300): D06330 D06331
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1128 (CHRM1)
   04024 cAMP signaling pathway
    1128 (CHRM1)
   04151 PI3K-Akt signaling pathway
    1128 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1128 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1128 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1128 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1128 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    1128 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1128 (CHRM1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    1128 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1128
NCBI-ProteinID: NP_000729
OMIM: 118510
HGNC: 1950
Ensembl: ENSG00000168539
Pharos: P11229(Tclin)
UniProt: P11229 Q53XZ3
Structure
LinkDB
Position
11:complement(62908679..62921878)
AA seq 460 aa
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacacttcagccccacctgctgtcagccccaacatcaccgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctagccacagtg
acaggcaacctgctggtactcatctctttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacgctggcttgtgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagc
tttgaccgctacttctccgtgactcggcccctgagctaccgtgccaagcgcacaccccgc
cgggcagctctgatgatcggcctggcctggctggtttcctttgtgctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgctagctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagaaccgagcacgg
gagctggcagcccttcagggctccgagacgccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggctcaccagagactcctccaggccgctgctgt
cgctgctgccgggcccccaggctgctgcaggcctacagctggaaggaagaagaggaagag
gacgaaggctccatggagtccctcacatcctcagagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccccgaggcacaggcccccaccaagcagcccccacgg
agctccccaaatacagtcaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtggaaaggagcagctggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacacctttcgcctgctgctgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccctggctccgtgcaccgcactccctcccgccaatgc
tga

KEGG   Homo sapiens (human): 1131
Entry
1131              CDS       T01001                                 
Symbol
CHRM3, EGBRS, HM3, PBS
Name
(RefSeq) cholinergic receptor muscarinic 3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa04742  Taste transduction
hsa04810  Regulation of actin cytoskeleton
hsa04911  Insulin secretion
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
  Element
N01000  mAChR-Ca2+ -apoptotic pathway
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
Disease
H02129  Prune belly syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Aclatonium (DG01291): D01955
Aclidinium bromide: D08837<JP/US>
Alvameline maleate: D02876
Anisotropine methylbromide: D00232
Atropine (DG00052): D00113<US> D02069<JP/US>
Atropine oxide (DG01243): D03011 D07477
Batefenterol (DG01627): D10545 D10546
Benapryzine hydrochloride: D03076
Benzatropine (DG00859): D00778<US> D07511
Benzetimide (DG01301): D03087 D07513
Benzilone: D03088
Bethanechol (DG00991): D01000<JP/US>
Bevonium: D01532
Biperiden (DG00852): D00779 D02246<JP> D02247<JP>
Blarcamesine (DG03048): D11383 D11549
Bornaprine: D07302
Butropium bromide: D01491<JP>
Butylscopolamine: D01451<JP>
Carbachol: D00524<US>
Carpronium (DG01289): D01175<JP> D09752<JP>
Cevimeline (DG00993): D00661<JP/US> D07667
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Choline alfoscerate: D07349
Cimetropium bromide: D07099
Clidinium bromide: D00716
Cyclopentolate (DG01141): D01002<JP/US> D07759
Darifenacin (DG00482): D01699<US> D03654
Darotropium bromide: D09402
Desfesoterodine: D10853
Dexetimide (DG00856): D03711 D07804
Dexpanthenol: D00193<JP>
Dicycloverine (DG00032): D00717<US> D07820
Diethazine (DG01921): D02603 D07823
Difemerine: D07079
Dihexyverine (DG00033): D03824 D07821
Diphemanil: D06878
Diphenidol (DG02880): D01318<JP> D03858 D03859
Diphenylpiperidinomethyldioxolan iodide: D01600
Diponium bromide: D01463
Elantrine: D03970
Elucaine: D03979
Esoxybutynin chloride: D04057
Etomidoline: D01359
Etybenzatropine: D04087
Eucatropine hydrochloride: D04116
Fenpiverinium: D07070
Fentonium: D07951
Fesoterodine (DG00483): D07226 D08923<JP/US>
Flutropium bromide: D02417
Glycopyrronium: D00540<JP/US>
Glycopyrronium (DG02467): D10938 D10939<JP/US>
Heteronium bromide: D04434
Hexocyclium (DG00039): D01003
Homatropine (DG01142): D01004
Homatropine methylbromide: D02070
Hyoscyamine (DG00053): D00147 D00719 D01648 D04479
Imidafenacin: D06273<JP>
Ipratropium bromide: D02212<JP/US>
Isopropamide (DG00038): D01005
Mazaticol (DG00857): D03264<JP> D08157
Mebeverine (DG00030): D04868 D08160
Mepenzolate (DG00040): D00720<JP>
Methacholine: D04970<JP/US>
Methantheline (DG00036): D00721
Methscopolamine bromide: D00715<US>
Methylatropine (DG01242): D01077 D03814
Methylbenactyzium bromide: D01315
Methylscopolamine: D01976<JP>
Metixene (DG00853): D01871 D08209
Metoquizine: D05012
Milameline hydrochloride: D05035
Navafenterol (DG03123): D11900 D11901
Otilonium bromide: D07083
Oxapium iodide: D01815
Oxitropium bromide: D01946
Oxybutynin (DG00478): D00465<US> D00722<JP/US>
Oxyphencyclimine (DG00029): D01006 D08325
Parapenzolate bromide: D05360
Pentapiperium methylsulfate: D05418
Penthienate: D07081
Phencarbamide: D05452
Phenglutarimide: D07301
Pilocarpine (DG00992): D00525 D02200<JP/US> D05478 D08376
Pipenzolate: D07084
Piperidolate (DG00034): D01165<JP> D08382
Pipethanate (DG01255): D01521 D08384
Pipethanate ethobromide: D01987
Pirenzepine (DG00026): D01297 D05276<JP> D08389
Piroheptine (DG01272): D01231<JP> D08395
Poldine: D05535
Pridinol (DG00774): D02064<JP> D08418 D08419
Prifinium bromide: D01377
Procyclidine (DG00854): D00782 D08425
Profenamine (DG00855): D01118 D03276 D08426
Propantheline (DG00035): D00481<JP/US>
Propenzolate hydrochloride: D05628
Propiverine (DG00479): D01007<JP> D08441
Rapacuronium bromide: D05703
Revefenacin: D10978<US>
Rociverine: D07078
Rocuronium bromide: D00765<JP/US>
Scopolamine (DG00065): D00138<US> D02071<JP>
Sofpironium bromide: D10989<JP>
Solifenacin (DG00481): D01269<JP/US> D08522
Tazomeline citrate: D06015
Tematropium methylsulfate: D06061
Tiemonium (DG01254): D08595
Tiemonium iodide: D01201
Timepidium bromide (DG00041): D02535<JP>
Tiotropium bromide: D01929<JP/US>
Tiquizium bromide: D01875<JP>
Tofenacin hydrochloride: D06175
Tolterodine (DG00480): D00646 D01148<JP/US>
Toquizine: D06192
Triampyzine sulfate: D06217
Tridihexethyl (DG00037): D00723
Trihexyphenidyl (DG00851): D00787<JP/US> D08638
Tropatepine (DG00858): D07303 D08653
Tropicamide: D00397<JP/US>
Trospium: D01103<US>
Umeclidinium (DG01253): D10180
Umeclidinium bromide: D10181<JP/US>
Valethamate: D01538
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1131 (CHRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1131 (CHRM3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1131 (CHRM3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    1131 (CHRM3)
  09154 Digestive system
   04970 Salivary secretion
    1131 (CHRM3)
   04971 Gastric acid secretion
    1131 (CHRM3)
   04972 Pancreatic secretion
    1131 (CHRM3)
  09156 Nervous system
   04725 Cholinergic synapse
    1131 (CHRM3)
  09157 Sensory system
   04742 Taste transduction
    1131 (CHRM3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1131 (CHRM3)
   05022 Pathways of neurodegeneration - multiple diseases
    1131 (CHRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1131 (CHRM3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    1131 (CHRM3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 1131
NCBI-ProteinID: NP_000731
OMIM: 118494
HGNC: 1952
Ensembl: ENSG00000133019
Pharos: P20309(Tclin)
UniProt: P20309 A0A024R3W1
Structure
LinkDB
Position
1:239386568..239915450
AA seq 590 aa
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaccttgcacaataacagtacaacctcgcctttgtttccaaacatcagctcctcctgg
atacacagcccctccgatgcagggctgcccccgggaaccgtcactcatttcggcagctac
aatgtttctcgagcagctggcaatttctcctctccagacggtaccaccgatgaccctctg
ggaggtcataccgtctggcaagtggtcttcatcgctttcttaacgggcatcctggccttg
gtgaccatcatcggcaacatcctggtaattgtgtcatttaaggtcaacaagcagctgaag
acggtcaacaactacttcctcttaagcctggcctgtgccgatctgattatcggggtcatt
tcaatgaatctgtttacgacctacatcatcatgaatcgatgggccttagggaacttggcc
tgtgacctctggcttgccattgactacgtagccagcaatgcctctgttatgaatcttctg
gtcatcagctttgacagatacttttccatcacgaggccgctcacgtaccgagccaaacga
acaacaaagagagccggtgtgatgatcggtctggcttgggtcatctcctttgtcctttgg
gctcctgccatcttgttctggcaatactttgttggaaagagaactgtgcctccgggagag
tgcttcattcagttcctcagtgagcccaccattacttttggcacagccatcgctgctttt
tatatgcctgtcaccattatgactattttatactggaggatctataaggaaactgaaaag
cgtaccaaagagcttgctggcctgcaagcctctgggacagaggcagagacagaaaacttt
gtccaccccacgggcagttctcgaagctgcagcagttacgaacttcaacagcaaagcatg
aaacgctccaacaggaggaagtatggccgctgccacttctggttcacaaccaagagctgg
aaacccagctccgagcagatggaccaagaccacagcagcagtgacagttggaacaacaat
gatgctgctgcctccctggagaactccgcctcctccgacgaggaggacattggctccgag
acgagagccatctactccatcgtgctcaagcttccgggtcacagcaccatcctcaactcc
accaagttaccctcatcggacaacctgcaggtgcctgaggaggagctggggatggtggac
ttggagaggaaagccgacaagctgcaggcccagaagagcgtggacgatggaggcagtttt
ccaaaaagcttctccaagcttcccatccagctagagtcagccgtggacacagctaagact
tctgacgtcaactcctcagtgggtaagagcacggccactctacctctgtccttcaaggaa
gccactctggccaagaggtttgctctgaagaccagaagtcagatcactaagcggaaaagg
atgtccctggtcaaggagaagaaagcggcccagaccctcagtgcgatcttgcttgccttc
atcatcacttggaccccatacaacatcatggttctggtgaacaccttttgtgacagctgc
atacccaaaaccttttggaatctgggctactggctgtgctacatcaacagcaccgtgaac
cccgtgtgctatgctctgtgcaacaaaacattcagaaccactttcaagatgctgctgctg
tgccagtgtgacaaaaaaaagaggcgcaagcagcagtaccagcagagacagtcggtcatt
tttcacaagcgcgcacccgagcaggccttgtag

KEGG   Homo sapiens (human): 1133
Entry
1133              CDS       T01001                                 
Symbol
CHRM5, HM5
Name
(RefSeq) cholinergic receptor muscarinic 5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa04810  Regulation of actin cytoskeleton
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
  Element
N01000  mAChR-Ca2+ -apoptotic pathway
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Aclatonium (DG01291): D01955
Aclidinium bromide: D08837<JP/US>
Anisotropine methylbromide: D00232
Atropine (DG00052): D00113<US> D02069<JP/US>
Atropine oxide (DG01243): D03011 D07477
Batefenterol (DG01627): D10545 D10546
Benapryzine hydrochloride: D03076
Benzatropine (DG00859): D00778<US> D07511
Benzetimide (DG01301): D03087 D07513
Benzilone: D03088
Bethanechol (DG00991): D01000<JP/US>
Bevonium: D01532
Biperiden (DG00852): D00779 D02246<JP> D02247<JP>
Blarcamesine (DG03048): D11383 D11549
Bornaprine: D07302
Butropium bromide: D01491<JP>
Butylscopolamine: D01451<JP>
Carbachol: D00524<US>
Carpronium (DG01289): D01175<JP> D09752<JP>
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Choline alfoscerate: D07349
Cimetropium bromide: D07099
Clidinium bromide: D00716
Cyclopentolate (DG01141): D01002<JP/US> D07759
Darotropium bromide: D09402
Dexetimide (DG00856): D03711 D07804
Diethazine (DG01921): D02603 D07823
Difemerine: D07079
Dihexyverine (DG00033): D03824 D07821
Diphenidol (DG02880): D01318<JP> D03858 D03859
Diphenylpiperidinomethyldioxolan iodide: D01600
Diponium bromide: D01463
Elantrine: D03970
Elucaine: D03979
Etomidoline: D01359
Etybenzatropine: D04087
Eucatropine hydrochloride: D04116
Fenpiverinium: D07070
Fentonium: D07951
Flutropium bromide: D02417
Glycopyrronium (DG02467): D10939<JP/US>
Heteronium bromide: D04434
Homatropine (DG01142): D01004
Homatropine methylbromide: D02070
Hyoscyamine (DG00053): D00147 D00719 D01648 D04479
Ipratropium bromide: D02212<JP/US>
Mazaticol (DG00857): D03264<JP> D08157
Mebeverine (DG00030): D04868 D08160
Mepenzolate (DG00040): D00720<JP>
Methacholine: D04970<JP/US>
Methantheline (DG00036): D00721
Methscopolamine bromide: D00715<US>
Methylatropine (DG01242): D01077 D03814
Methylbenactyzium bromide: D01315
Methylscopolamine: D01976<JP>
Metixene (DG00853): D01871 D08209
Metoquizine: D05012
Milameline hydrochloride: D05035
Otilonium bromide: D07083
Oxapium iodide: D01815
Oxitropium bromide: D01946
Oxybutynin (DG00478): D00465<US> D00722<JP/US>
Parapenzolate bromide: D05360
Pentapiperium methylsulfate: D05418
Penthienate: D07081
Phencarbamide: D05452
Phenglutarimide: D07301
Pipenzolate: D07084
Piperidolate (DG00034): D01165<JP> D08382
Pipethanate (DG01255): D01521 D08384
Pipethanate ethobromide: D01987
Pirenzepine (DG00026): D01297 D05276<JP> D08389
Piroheptine (DG01272): D01231<JP> D08395
Poldine: D05535
Pridinol (DG00774): D02064<JP> D08418 D08419
Prifinium bromide: D01377
Procyclidine (DG00854): D00782 D08425
Profenamine (DG00855): D01118 D03276 D08426
Propantheline (DG00035): D00481<JP/US>
Propenzolate hydrochloride: D05628
Propiverine (DG00479): D01007<JP> D08441
Rapacuronium bromide: D05703
Rocuronium bromide: D00765<JP/US>
Scopolamine (DG00065): D00138<US> D02071<JP>
Tazomeline citrate: D06015
Tematropium methylsulfate: D06061
Tiemonium (DG01254): D08595
Tiemonium iodide: D01201
Timepidium bromide (DG00041): D02535<JP>
Tofenacin hydrochloride: D06175
Toquizine: D06192
Triampyzine sulfate: D06217
Trihexyphenidyl (DG00851): D00787<JP/US> D08638
Tropatepine (DG00858): D07303 D08653
Tropicamide: D00397<JP/US>
Umeclidinium (DG01253): D10180
Umeclidinium bromide: D10181<JP/US>
Valethamate: D01538
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1133 (CHRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1133 (CHRM5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1133 (CHRM5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1133 (CHRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1133 (CHRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    1133 (CHRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1133 (CHRM5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    1133 (CHRM5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srbc
Other DBs
NCBI-GeneID: 1133
NCBI-ProteinID: NP_001307846
OMIM: 118496
HGNC: 1954
Ensembl: ENSG00000184984
Pharos: P08912(Tclin)
UniProt: P08912 A0A024R9I2
Structure
LinkDB
Position
15:33968497..34067458
AA seq 532 aa
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL
DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE
KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL
TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN
YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP
NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG
YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaggggattcttaccacaatgcaaccaccgtcaatggcaccccagtaaatcaccag
cctttggaacgccacaggttgtgggaagtcatcaccattgcagctgtgactgctgtggta
agcctgatcaccattgtgggcaatgtcttggtcatgatctccttcaaagtcaacagccag
ctcaagacagttaacaactattacctgctcagcttagcctgtgcagatctcatcattgga
atcttctccatgaacctctacaccacctacatcctcatgggacgctgggctctcgggagt
ctggcttgtgacctttggcttgcactggactacgtggccagcaacgcttctgtcatgaac
cttctggtgatcagttttgaccgttacttttccatcacaagacccttgacatatcgggcc
aagcgtactccgaaaagggctggcatcatgattggcttggcctggctgatctccttcatc
ctctgggccccagcaatcctctgctggcagtacttggttgggaagcggacagttccactg
gatgagtgccagatccagtttctctctgagcccaccatcacttttggcactgccattgct
gccttctacatccctgtttctgtcatgaccatcctctactgtcgaatctaccgggaaaca
gagaagcgaaccaaggacctggctgacctccagggttctgactctgtgaccaaagctgag
aagagaaagccagctcatagggctctgttcagatcctgcttgcgctgtcctcgacccacc
ctggcccagcgggaaaggaaccaggcctcctggtcatcctcccgcaggagcacctccacc
actgggaagccatcccaagccactggcccaagcgccaattgggccaaagctgagcagctc
accacctgtagcagctacccttcctcagaggatgaggacaagcccgccactgaccctgtc
ctccaagtggtctacaagagtcagggtaaggaaagcccaggggaagaattcagtgctgaa
gagactgaggaaacttttgtgaaagctgaaactgaaaaaagtgactatgacaccccaaac
taccttctgtctccagcagctgctcatagacccaagagtcagaaatgtgtggcctataag
ttccgattggtggtaaaagctgacgggaaccaggagaccaacaatggctgtcacaaggtg
aaaatcatgccctgccccttcccagtggccaaggaaccttcaacgaaaggcctcaatccc
aaccccagccatcaaatgaccaaacgaaagagagtggtcctagtcaaagagaggaaagca
gcccagacactgagtgccattctcctggccttcatcatcacatggaccccgtataacatc
atggtcctggtttctaccttctgtgacaagtgtgtcccagtcaccctgtggcacttgggc
tattggttgtgctatgtcaatagcactgtcaaccccatctgctatgccctctgcaacaga
accttcaggaagacctttaagatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtactggcaggggaacagcaagctaccctga

KEGG   Homo sapiens (human): 2915
Entry
2915              CDS       T01001                                 
Symbol
GRM5, GPRC1E, MGLUR5, PPP1R86, mGlu5
Name
(RefSeq) glutamate metabotropic receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
Drug target
Fenobam: D04155
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2915 (GRM5)
   04072 Phospholipase D signaling pathway
    2915 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2915 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2915 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2915 (GRM5)
   04720 Long-term potentiation
    2915 (GRM5)
   04723 Retrograde endocannabinoid signaling
    2915 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2915 (GRM5)
   05016 Huntington disease
    2915 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    2915 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2915 (GRM5)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2915 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438
Other DBs
NCBI-GeneID: 2915
NCBI-ProteinID: NP_001137303
OMIM: 604102
HGNC: 4597
Ensembl: ENSG00000168959
Pharos: P41594(Tchem)
UniProt: P41594
Structure
LinkDB
Position
11:complement(88504642..89065982)
AA seq 1212 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
NT seq 3639 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccgggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcggtc
cgtgaacagtatggcattcagagagtggaggccatgctgcataccctggaaaggatcaat
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggactcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagaaggcttggtacgctgtgtggatggctcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaat
ttgctccagcttttcaacatacctcagattgcttactcagcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaggcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagccgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaaaatctacagtaatgcaggggagcagagctttgataagctg
ctgaagaagctcacaagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaagctccaatctcccgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccaccgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctatgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgccatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatacgatcctattcgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattactttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtacacatgcaaggcatgccaactggggtcttggcccactgat
gatctcacaggttgtgacttgatcccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctggccaccctgtttgttactgtagtc
ttcatcatttaccgtgatacaccagtagtcaagtcctcaagcagggaactctgctacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcgaagcccaaa
cagatttactgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacctaggagtt
gtcactccacttggatacaatggattgttgattttgagctgcaccttctatgcgttcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggtcagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaacgtgcgcagcgccttcaccacatct
accgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagttccaatggaaaatccgtcacgtgggcccagaat
gagaagagcagccgggggcagcacctgtggcagcgcctgtccatccacatcaacaagaaa
gaaaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgtggc
ctgggcgctggcgctggcgcaggcgggagcgctgggggcgtgggggccacgggcggtgcg
ggctgcgcaggcgccggcccaggcgggcccgagtccccagacgccggccccaaggcgctg
tatgatgtggccgaggctgaggagcacttcccggcgcccgcgcggccgcgctcaccgtcg
cccatcagcacgctgagccaccgcgcgggctcggccagccgcacggacgacgatgtgccg
tcgctgcactcggagcctgtggcgcgcagcagctcctcgcagggctccctcatggagcag
atcagcagtgtggtcacccgcttcacggccaacatcagcgagctcaactccatgatgctg
tccaccgcggcccccagccccggcgtcggcgccccgctctgctcgtcctacctgatcccc
aaagagatccagttgcccacgaccatgacgacctttgccgaaatccagcctctgccggcc
atcgaagtcacgggaggcgcgcagcccgcggcaggggcgcaggcggctggggacgcggcc
cgggagagccccgcggccggtcccgaggctgcggccgccaagccagacctggaggagctg
gtggctctcaccccgccgtcccccttcagagactcggtggactcggggagcacaaccccc
aactcgccagtgtccgagtcggccctctgtatcccgtcgtctcccaaatatgacactctt
atcataagagattacactcagagctcctcgtcgttgtga

DBGET integrated database retrieval system