KEGG   Homo sapiens (human): 6714
Entry
6714              CDS       T01001                                 
Symbol
SRC, ASV, SRC1, THC6, c-SRC, p60-Src
Name
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04137  Mitophagy - animal
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04625  C-type lectin receptor signaling pathway
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05219  Bladder cancer
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06223  TNF signaling
nt06230  Cell cycle
nt06263  Hepatocellular carcinoma
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01079  Shigella IpaC to Actin signaling pathway
N01091  Escherichia EspJ to IGG-FCGR-RAC signaling pathway
N01336  CHRNA7-E2F signaling pathway
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
N01352  BPA to RAS-ERK signaling pathway
N01353  E2 to RAS-ERK signaling pathway
N01358  P4-PR-PI3K signaling pathway
N01359  P4/MPA to PR-PI3K signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01411  Metals to NFKB signaling pathway
Disease
H00978  Thrombocytopenia (THC)
Drug target
Bosutinib (DG00718): D03252 D09728<JP/US>
Dasatinib (DG00714): D03658<JP> D06414<JP/US>
Ilorasertib: D10423
Saracatinib (DG01418): D09664 D09665
Tirbanibulin (DG03082): D11691<US> D11692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    6714 (SRC)
   04015 Rap1 signaling pathway
    6714 (SRC)
   04370 VEGF signaling pathway
    6714 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6714 (SRC)
   04137 Mitophagy - animal
    6714 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    6714 (SRC)
   04520 Adherens junction
    6714 (SRC)
   04530 Tight junction
    6714 (SRC)
   04540 Gap junction
    6714 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6714 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6714 (SRC)
   04613 Neutrophil extracellular trap formation
    6714 (SRC)
   04625 C-type lectin receptor signaling pathway
    6714 (SRC)
   04062 Chemokine signaling pathway
    6714 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6714 (SRC)
   04915 Estrogen signaling pathway
    6714 (SRC)
   04917 Prolactin signaling pathway
    6714 (SRC)
   04921 Oxytocin signaling pathway
    6714 (SRC)
   04926 Relaxin signaling pathway
    6714 (SRC)
   04919 Thyroid hormone signaling pathway
    6714 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    6714 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6714 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    6714 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6714 (SRC)
   05207 Chemical carcinogenesis - receptor activation
    6714 (SRC)
   05208 Chemical carcinogenesis - reactive oxygen species
    6714 (SRC)
   05203 Viral carcinogenesis
    6714 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    6714 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    6714 (SRC)
   05168 Herpes simplex virus 1 infection
    6714 (SRC)
   05163 Human cytomegalovirus infection
    6714 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6714 (SRC)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6714 (SRC)
   05130 Pathogenic Escherichia coli infection
    6714 (SRC)
   05131 Shigellosis
    6714 (SRC)
   05135 Yersinia infection
    6714 (SRC)
   05152 Tuberculosis
    6714 (SRC)
   05100 Bacterial invasion of epithelial cells
    6714 (SRC)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6714 (SRC)
   05418 Fluid shear stress and atherosclerosis
    6714 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    6714 (SRC)
   01522 Endocrine resistance
    6714 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6714 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6714 (SRC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6714 (SRC)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   6714 (SRC)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    6714 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    6714 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    6714 (SRC)
  Macropinocytosis
   Kinases
    6714 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 ABC1 SH3_10 Haspin_kinase SH3_3
Other DBs
NCBI-GeneID: 6714
NCBI-ProteinID: NP_005408
OMIM: 190090
HGNC: 11283
Ensembl: ENSG00000197122
Pharos: P12931(Tclin)
UniProt: P12931
Structure
LinkDB
Position
20:37344699..37406050
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatcgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtacgtg
gagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggcggactttgggctggctcggctcattgaagacaatgagtacacg
gcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtccttcgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

KEGG   Homo sapiens (human): 5747
Entry
5747              CDS       T01001                                 
Symbol
PTK2, FADK, FADK_1, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
Name
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04935  Growth hormone synthesis, secretion and action
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05222  Small cell lung cancer
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
N01083  Shigella OspE to ITGA/B-TALIN/VINCULIN signaling pathway
N01111  Yersinia YopH to ITGA/B-FAK-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    5747 (PTK2)
   04370 VEGF signaling pathway
    5747 (PTK2)
   04151 PI3K-Akt signaling pathway
    5747 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5747 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5747 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5747 (PTK2)
   04062 Chemokine signaling pathway
    5747 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    5747 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    5747 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5747 (PTK2)
   05202 Transcriptional misregulation in cancer
    5747 (PTK2)
   05205 Proteoglycans in cancer
    5747 (PTK2)
   05208 Chemical carcinogenesis - reactive oxygen species
    5747 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    5747 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5747 (PTK2)
   05163 Human cytomegalovirus infection
    5747 (PTK2)
   05165 Human papillomavirus infection
    5747 (PTK2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5747 (PTK2)
   05135 Yersinia infection
    5747 (PTK2)
   05100 Bacterial invasion of epithelial cells
    5747 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5747 (PTK2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5747 (PTK2)
   05418 Fluid shear stress and atherosclerosis
    5747 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5747 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5747 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5747 (PTK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     5747 (PTK2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  FAK family
   5747 (PTK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5747 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like Haspin_kinase ABC1
Other DBs
NCBI-GeneID: 5747
NCBI-ProteinID: NP_722560
OMIM: 600758
HGNC: 9611
Ensembl: ENSG00000169398
Pharos: Q05397(Tchem)
UniProt: Q05397 Q658W2 Q59GM6
Structure
LinkDB
Position
8:complement(140657900..141002079)
AA seq 1052 aa
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3159 nt   +upstreamnt  +downstreamnt
atggcagctgcttaccttgaccccaacttgaatcacacaccaaattcgagtactaagact
cacctgggtactggtatggaacgttctcctggtgcaatggagcgagtattaaaggtcttt
cattattttgaaagcaatagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcatgtg
gcctgctatggattccgcctcagtcacctgcggtcagaggaggttcactggcttcacgtg
gatatgggcgtctccagtgtgagggagaagtatgagcttgctcacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaactttgaatttcttctatcaacaggtgaagagcgattatatgttagagatagct
gatcaagtggaccaggaaattgctttgaagttgggttgtctagaaatacggcgatcatac
tgggagatgcggggcaatgcactagaaaagaagtctaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaaactgatccaacaaacatttagacaatttgccaaccttaatagagaagaaagtatt
ctgaaattctttgagatcctgtctccagtctacagatttgataaggaatgcttcaagtgt
gctcttggttcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcactcaagtgcaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacccgagcctctgacagtgacggcaccatccctaaccattgcggagaatatg
gctgacctaatagatgggtactgccggctggtgaatggaacctcgcagtcatttatcatc
agacctcagaaagaaggtgaacgggctttgccatcaataccaaagttggccaacagcgaa
aagcaaggcatgcggacacacgccgtctctgtgtcagaaacagatgattatgctgagatt
atagatgaagaagatacttacaccatgccctcaaccagggattatgagattcaaagagaa
agaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggcatt
tatatgagtccagagaatccagctttggcggttgcaattaaaacatgtaaaaactgtact
tcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcagtttgaccat
cctcatattgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggag
ctgtgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggatcta
gcatctttgatcctgtatgcctatcagcttagtacagctcttgcatatctagagagcaaa
agatttgtacacagggacattgctgctcggaatgttctggtgtcctcaaatgattgtgta
aaattaggagactttggattatcccgatatatggaagatagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtatggatgtttggtgtgtgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtaatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctg
gaggaagagaaggctcagcaagaagagcgcatgaggatggagtccagaagacaggccaca
gtgtcctgggactccggagggtctgatgaagcaccgcccaagcccagcagaccgggttat
cccagtccgaggtccagcgaaggattttatcccagcccacagcacatggtacaaaccaat
cattaccaggtttctggctaccctggttcacatggaatcacagccatggctggcagcatc
tatccaggtcaggcatctcttttggaccaaacagattcatggaatcatagacctcaggag
atagcaatgtggcagcccaatgtggaggactctacagtattggacctgcgagggattggg
caagtgttgccaacccatctgatggaagagcgtctaatccgacagcaacaggaaatggaa
gaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctct
cgaggcagtattgacagggaggatggaagtcttcagggtccgattggaaaccaacatata
tatcagcctgtgggtaaaccagatcctgcagctccaccaaagaaaccgcctcgccctgga
gctcccggtcatctgggaagccttgccagcctcagcagccctgctgacagctacaacgag
ggtgtcaagcttcagccccaggaaatcagcccccctcctactgccaacctggaccggtcg
aatgataaggtgtacgagaatgtgacgggcctggtgaaagctgtcatcgagatgtccagt
aaaatccagccagccccaccagaggagtatgtccctatggtgaaggaagtcggcttggcc
ctgaggacattattggccactgtggatgagaccattcccctcctaccagccagcacccac
cgagagattgagatggcacagaagctattgaactctgacctgggtgagctcatcaacaag
atgaaactggcccagcagtatgtcatgaccagcctccagcaagagtacaaaaagcaaatg
ctgactgctgctcacgccctggctgtggatgccaaaaacttactcgatgtcattgaccaa
gcaagactgaaaatgcttgggcagacgagaccacactga

DBGET integrated database retrieval system