KEGG   Homo sapiens (human): 146
Entry
146               CDS       T01001                                 

Symbol
ADRA1D, ADRA1, ADRA1A, ADRA1R, ALPHA1, DAR, dJ779E11.2
Name
(RefSeq) adrenoceptor alpha 1D
  KO
K04137  adrenergic receptor alpha-1D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04970  Salivary secretion
Drug target
Adrenalone (DG00016): D02774 D07560
Amidephrine mesylate: D02901
Amiodarone (DG00204): D00636<JP/US> D02910
Amosulalol (DG01302): D01469<JP> D07451
Arotinolol (DG01303): D01830<JP> D07465
Bevantolol: D01369<JP>
Bunazosin (DG01316): D01887<JP> D07550
Bunitrolol hydrochloride: D01444
Carvedilol (DG00321): D00255<JP/US> D03415<US>
Dapiprazole (DG01140): D03648<US> D07775
Dihydroergocristine (DG00284): D07833 D07834
Dipivefrine (DG01129): D01017<JP> D02349
Domazoline fumarate: D03887
Doxazosin (DG00256): D00608<JP/US> D07874
Dronedarone (DG00207): D02537 D03914<US>
Droperidol: D00308<JP/US>
Droxidopa: D01277<JP/US>
Ephedrine (DG00227): D00124 D01386<JP/US> D04018<US>
Epinephrine (DG00013): D00095<JP/US> D00996 D02149
Epinephryl borate: D04026
Ergoloid mesylates: D02268
Ergometrine (DG00446): D01163<JP> D07905
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Etilefrine (DG00210): D01573<JP> D07931
Flesinoxan: D02568
Guanadrel: D08029
Guanadrel sulfate: D00607
Ifenprodil (DG00292): D01445<JP> D08064
Indoramin (DG00254): D04531 D04532
Labetalol (DG00320): D00600<JP/US> D08106
Levobunolol (DG01136): D01025<JP/US> D08115
Metaraminol (DG00218): D01019 D08192
Methoxamine (DG00219): D01020 D08201
Methylephedrine (DG01229): D01952 D02109<JP> D08206 D09842
Methylergometrine (DG00445): D00680<JP/US> D08207
Midodrine (DG00224): D01307<JP/US> D08220
Monatepil maleate: D01171
Moxisylyte (DG00287): D01571 D08239
Naftopidil: D01674<JP>
Naphazoline (DG01032): D00743 D01021<JP> D08253
Nefazodone (DG00953): D00819<US> D08257
Nicergoline (DG00283): D01290<JP> D08271
Nipradilol: D01691<JP>
Norepinephrine (DG00212): D00076<JP> D05206<US> D08284 D09794
Octodrine: D05228
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Pelanserin hydrochloride: D05395
Periciazine: D01485<JP>
Phenoxybenzamine (DG00285): D00507<US> D08358
Phentolamine (DG00280): D00509<JP/US> D08362
Phenylephrine (DG00215): D00511<JP/US> D08365 D08366 D08966
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Prazosin (DG00253): D00609<JP/US> D08411
Propylhexedrine (DG01919): D05637 D08444
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Racepinephrine (DG01444): D05688 D05689
Tamsulosin (DG00490): D01024<JP/US> D08560
Terazosin (DG00491): D00610<JP/US> D08569 D11585<US>
Tetryzoline (DG01030): D00756 D01023 D08578
Tolazoline (DG00281): D00997 D08614
Tramazoline (DG01033): D01347<JP> D08624
Trimazosin (DG00255): D06234 D08212
Urapidil (DG00257): D01333<JP> D08662
Xylometazoline (DG01031): D00757 D08684
Zolertine hydrochloride: D06380
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    146 (ADRA1D)
   04022 cGMP-PKG signaling pathway
    146 (ADRA1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    146 (ADRA1D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    146 (ADRA1D)
   04270 Vascular smooth muscle contraction
    146 (ADRA1D)
  09154 Digestive system
   04970 Salivary secretion
    146 (ADRA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    146 (ADRA1D)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    146 (ADRA1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 146
NCBI-ProteinID: NP_000669
OMIM: 104219
HGNC: 280
Ensembl: ENSG00000171873
Vega: OTTHUMG00000031779
Pharos: P25100(Tclin)
UniProt: P25100 B0ZBE0
LinkDB
Position
20p13
AA seq 572 aa
MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG
SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS
VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC
TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP
PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS
EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC
WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ
CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM
QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE
AVSLGVPHEVAEGATCQAYELADYSNLRETDI
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgactttccgcgatctcctgagcgtcagtttcgagggaccccgcccggacagcagcgca
gggggctccagcgcgggcggcggcgggggcagcgcgggcggcgcggccccctcggagggc
ccggcggtgggcggcgtgccggggggcgcgggcggcggcggcggcgtggtgggcgcaggc
agcggcgaggacaaccggagctccgcgggggagccggggagcgcgggcgcgggcggcgac
gtgaatggcacggcggccgtcgggggactggtggtgagcgcgcagggcgtgggcgtgggc
gtcttcctggcagccttcatccttatggccgtggcaggtaacctgcttgtcatcctctca
gtggcctgcaaccgccacctgcagaccgtcaccaactatttcatcgtgaacctggccgtg
gccgacctgctgctgagcgccaccgtactgcccttctcggccaccatggaggttctgggc
ttctgggcctttggccgcgccttctgcgacgtatgggccgccgtggacgtgctgtgctgc
acggcctccatcctcagcctctgcaccatctccgtggaccggtacgtgggcgtgcgccac
tcactcaagtacccagccatcatgaccgagcgcaaggcggccgccatcctggccctgctc
tgggtcgtagccctggtggtgtccgtagggcccctgctgggctggaaggagcccgtgccc
cctgacgagcgcttctgcggtatcaccgaggaggcgggctacgctgtcttctcctccgtg
tgctccttctacctgcccatggcggtcatcgtggtcatgtactgccgcgtgtacgtggtc
gcgcgcagcaccacgcgcagcctcgaggcgggcgtcaagcgcgagcgaggcaaggcctcc
gaggtggtgctgcgcatccactgtcgcggcgcggccacgggcgccgacggggcgcacggc
atgcgcagcgccaagggccacaccttccgcagctcgctctccgtgcgcctgctcaagttc
tcccgtgagaagaaagcggccaagactctggccatcgtcgtgggtgtcttcgtgctctgc
tggttccctttcttctttgtcctgccgctcggctccttgttcccgcagctgaagccatcg
gagggcgtcttcaaggtcatcttctggctcggctacttcaacagctgcgtgaacccgctc
atctacccctgttccagccgcgagttcaagcgcgccttcctccgtctcctgcgctgccag
tgccgtcgtcgccggcgccgccgccctctctggcgtgtctacggccaccactggcgggcc
tccaccagcggcctgcgccaggactgcgccccgagttcgggcgacgcgccccccggagcg
ccgctggccctcaccgcgctccccgaccccgaccccgaacccccaggcacgcccgagatg
caggctccggtcgccagccgtcgaaagccacccagcgccttccgcgagtggaggctgctg
gggccgttccggagacccacgacccagctgcgcgccaaagtctccagcctgtcgcacaag
atccgcgccgggggcgcgcagcgcgcagaggcagcgtgcgcccagcgctcagaggtggag
gctgtgtccctaggcgtcccacacgaggtggccgagggcgccacctgccaggcctacgaa
ttggccgactacagcaacctacgggagaccgatatttaa

DBGET integrated database retrieval system