KEGG   Homo sapiens (human): 4893
Entry
4893              CDS       T01001                                 
Symbol
NRAS, ALPS4, CMNS, KRAS, N-ras, NCMS, NRAS1, NS6
Name
(RefSeq) NRAS proto-oncogene, GTPase
  KO
K07828  GTPase NRas
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04714  Thermogenesis
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04929  GnRH secretion
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04935  Growth hormone synthesis, secretion and action
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05034  Alcoholism
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05417  Lipid and atherosclerosis
Network
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling (cancer)
nt06213  Other RAS signaling (cancer)
nt06214  PI3K signaling (cancer)
nt06224  CXCR signaling (cancer)
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
nt06324  GHRH-GH-IGF signaling
nt06460  Alzheimer disease
nt06466  Pathways of neurodegeneration
nt06526  MAPK signaling
nt06530  PI3K signaling
nt06543  NRG-ERBB signaling
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00003  Mutation-activated KIT to RAS-ERK signaling pathway
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00006  Amplified EGFR to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00008  RET fusion kinase to RAS-ERK signaling pathway
N00009  TRK fusion kinase to RAS-ERK signaling pathway
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00018  Amplified PDGFR to RAS-ERK signaling pathway
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00031  Duplication or mutation-activated FLT3 to RAS-PI3K signaling pathway
N00032  Mutation-activated KRAS/NRAS to PI3K signaling pathway
N00041  EGFR-overexpression to RAS-ERK signaling pathway
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to RAS-RASSF1 signaling pathway
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00152  CXCR-GNB/G-ERK signaling pathway
N00160  KSHV K1 to RAS-ERK signaling pathway
N00215  KITLG-KIT-RAS-ERK signaling pathway
N00216  HGF-MET-RAS-ERK signaling pathway
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00229  TGFA-EGFR-RAS-ERK signaling pathway
N00230  TGFA-overexpression to RAS-ERK signaling pathway
N00233  IGF-IGF1R-RAS-ERK signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00246  HGF-overexpression to RAS-ERK signaling pathway
N00248  MET-overexpression to RAS-ERK signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00259  Amplified MET to RAS-ERK signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00279  AREG-EGFR-RAS-ERK signaling pathway
N00280  AREG-overexpression to RAS-ERK signaling pathway
N00367  HPV E5 to EGFR-RAS-ERK signaling pathway
N00386  HCMV gB to PDGFR-RAS-ERK signaling pathway
N00513  Mutation-activated EGFR to RAS-ERK signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N00541  HBV HBx to RAS-ERK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01062  Mutation-activated MET to RAS-ERK signaling pathway
N01064  Mutation-activated RET to RAS-ERK signaling pathway
N01343  ACH-CHRN-RAS-ERK signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
N01352  BPA to RAS-ERK signaling pathway
N01353  E2 to RAS-ERK signaling pathway
N01354  BPA to RAS-ERK signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01408  Metals to RAS-ERK signaling pathway
N01592  GF-RTK-RAS-ERK signaling pathway
N01596  Regulation of GF-RTK-RAS-ERK signaling, RAS ubiquitination by CUL3 complex
N01597  Regulation of GF-RTK-RAS-ERK signaling, SPRED and NF1
N01600  Regulation of GF-RTK-RAS-ERK signaling, RasGAP
N01658  GF-RTK-RAS-PI3K signaling pathway
N01874  NRG-ERBB2/ERBB3 pathway (RAS-ERK signaling)
Disease
H00003  Acute myeloid leukemia
H00010  Multiple myeloma
H00016  Oral cancer
H00018  Gastric cancer
H00032  Thyroid cancer
H00033  Adrenal carcinoma
H00038  Melanoma
H00108  Autoimmune lymphoproliferative syndromes
H00523  Noonan syndrome and related disorders
H01666  Angiosarcoma
H01738  Noonan syndrome
H02410  Myelodysplastic/myeloproliferative neoplasms
H02411  Chronic myelomonocytic leukemia
H02412  Atypical chronic myeloid leukemia
H02425  Erdheim-Chester disease
H02541  Juvenile myelomonocytic leukemia
H02627  Epidermal nevus
H02628  Schimmelpenning-Feuerstein-Mims syndrome
H02874  Congenital melanocytic nevus syndrome
H02875  Neurocutaneous melanosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4893 (NRAS)
   04015 Rap1 signaling pathway
    4893 (NRAS)
   04068 FoxO signaling pathway
    4893 (NRAS)
   04072 Phospholipase D signaling pathway
    4893 (NRAS)
   04071 Sphingolipid signaling pathway
    4893 (NRAS)
   04151 PI3K-Akt signaling pathway
    4893 (NRAS)
   04150 mTOR signaling pathway
    4893 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    4893 (NRAS)
   04137 Mitophagy - animal
    4893 (NRAS)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4893 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    4893 (NRAS)
   04660 T cell receptor signaling pathway
    4893 (NRAS)
   04662 B cell receptor signaling pathway
    4893 (NRAS)
   04664 Fc epsilon RI signaling pathway
    4893 (NRAS)
   04062 Chemokine signaling pathway
    4893 (NRAS)
  09152 Endocrine system
   04929 GnRH secretion
    4893 (NRAS)
   04915 Estrogen signaling pathway
    4893 (NRAS)
   04917 Prolactin signaling pathway
    4893 (NRAS)
   04921 Oxytocin signaling pathway
    4893 (NRAS)
   04926 Relaxin signaling pathway
    4893 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    4893 (NRAS)
   04919 Thyroid hormone signaling pathway
    4893 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    4893 (NRAS)
   04726 Serotonergic synapse
    4893 (NRAS)
   04720 Long-term potentiation
    4893 (NRAS)
   04730 Long-term depression
    4893 (NRAS)
   04722 Neurotrophin signaling pathway
    4893 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    4893 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    4893 (NRAS)
   04213 Longevity regulating pathway - multiple species
    4893 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    4893 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4893 (NRAS)
   05206 MicroRNAs in cancer
    4893 (NRAS)
   05205 Proteoglycans in cancer
    4893 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    4893 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    4893 (NRAS)
   05203 Viral carcinogenesis
    4893 (NRAS)
   05230 Central carbon metabolism in cancer
    4893 (NRAS)
   05231 Choline metabolism in cancer
    4893 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4893 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    4893 (NRAS)
   05225 Hepatocellular carcinoma
    4893 (NRAS)
   05226 Gastric cancer
    4893 (NRAS)
   05214 Glioma
    4893 (NRAS)
   05216 Thyroid cancer
    4893 (NRAS)
   05221 Acute myeloid leukemia
    4893 (NRAS)
   05220 Chronic myeloid leukemia
    4893 (NRAS)
   05218 Melanoma
    4893 (NRAS)
   05211 Renal cell carcinoma
    4893 (NRAS)
   05219 Bladder cancer
    4893 (NRAS)
   05215 Prostate cancer
    4893 (NRAS)
   05213 Endometrial cancer
    4893 (NRAS)
   05224 Breast cancer
    4893 (NRAS)
   05223 Non-small cell lung cancer
    4893 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4893 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    4893 (NRAS)
   05161 Hepatitis B
    4893 (NRAS)
   05160 Hepatitis C
    4893 (NRAS)
   05163 Human cytomegalovirus infection
    4893 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4893 (NRAS)
   05165 Human papillomavirus infection
    4893 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4893 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    4893 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    4893 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    4893 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    4893 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    4893 (NRAS)
   01522 Endocrine resistance
    4893 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4893 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4893 (NRAS)
   04031 GTP-binding proteins [BR:hsa04031]
    4893 (NRAS)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    4893 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    4893 (NRAS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4893 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   4893 (NRAS)
  Exosomal proteins of breast cancer cells
   4893 (NRAS)
  Exosomal proteins of colorectal cancer cells
   4893 (NRAS)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    4893 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 4893
NCBI-ProteinID: NP_002515
OMIM: 164790
HGNC: 7989
Ensembl: ENSG00000213281
UniProt: P01111 Q5U091
Structure
LinkDB
Position
1:complement(114704469..114716771)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaagtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system