| Entry |
|
| Symbol |
NRAS, ALPS4, CMNS, KRAS, N-ras, NCMS, NRAS1, NS6
|
| Name |
|
| KO |
|
| Organism |
|
| Pathway |
| hsa01521 | EGFR tyrosine kinase inhibitor resistance |
| hsa04072 | Phospholipase D signaling pathway |
| hsa04213 | Longevity regulating pathway - multiple species |
| hsa04550 | Signaling pathways regulating pluripotency of stem cells |
| hsa04625 | C-type lectin receptor signaling pathway |
| hsa04650 | Natural killer cell mediated cytotoxicity |
| hsa04660 | T cell receptor signaling pathway |
| hsa04662 | B cell receptor signaling pathway |
| hsa04664 | Fc epsilon RI signaling pathway |
| hsa04810 | Regulation of actin cytoskeleton |
| hsa04919 | Thyroid hormone signaling pathway |
| hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
| hsa04935 | Growth hormone synthesis, secretion and action |
| hsa05022 | Pathways of neurodegeneration - multiple diseases |
| hsa05163 | Human cytomegalovirus infection |
| hsa05166 | Human T-cell leukemia virus 1 infection |
| hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
| hsa05170 | Human immunodeficiency virus 1 infection |
| hsa05207 | Chemical carcinogenesis - receptor activation |
| hsa05208 | Chemical carcinogenesis - reactive oxygen species |
| hsa05230 | Central carbon metabolism in cancer |
| hsa05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
|
| Network |
|
| Element |
| N00001 | EGF-EGFR-RAS-ERK signaling pathway |
| N00002 | BCR-ABL fusion kinase to RAS-ERK signaling pathway |
| N00003 | Mutation-activated KIT to RAS-ERK signaling pathway |
| N00004 | Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway |
| N00005 | Mutation-activated MET to RAS-ERK signaling pathway |
| N00006 | Amplified EGFR to RAS-ERK signaling pathway |
| N00007 | EML4-ALK fusion kinase to RAS-ERK signaling pathway |
| N00008 | RET fusion kinase to RAS-ERK signaling pathway |
| N00009 | TRK fusion kinase to RAS-ERK signaling pathway |
| N00011 | Mutation-activated FGFR3 to RAS-ERK signaling pathway |
| N00012 | Mutation-activated KRAS/NRAS to ERK signaling pathway |
| N00014 | Mutation-activated EGFR to RAS-ERK signaling pathway |
| N00015 | PDGF-PDGFR-RAS-ERK signaling pathway |
| N00016 | PDGF-overexpression to RAS-ERK signaling pathway |
| N00018 | Amplified PDGFR to RAS-ERK signaling pathway |
| N00019 | FGF-FGFR-RAS-ERK signaling pathway |
| N00020 | Amplified FGFR to RAS-ERK signaling pathway |
| N00021 | EGF-ERBB2-RAS-ERK signaling pathway |
| N00022 | ERBB2-overexpression to RAS-ERK signaling pathway |
| N00030 | EGF-EGFR-RAS-PI3K signaling pathway |
| N00031 | Duplication or mutation-activated FLT3 to RAS-PI3K signaling pathway |
| N00032 | Mutation-activated KRAS/NRAS to PI3K signaling pathway |
| N00041 | EGFR-overexpression to RAS-ERK signaling pathway |
| N00096 | EGF-EGFR-RAS-RASSF1 signaling pathway |
| N00097 | Loss of RASSF1 to RAS-RASSF1 signaling pathway |
| N00103 | EGF-EGFR-RAS-RalGDS signaling pathway |
| N00152 | CXCR-GNB/G-ERK signaling pathway |
| N00160 | KSHV K1 to RAS-ERK signaling pathway |
| N00215 | KITLG-KIT-RAS-ERK signaling pathway |
| N00216 | HGF-MET-RAS-ERK signaling pathway |
| N00217 | FLT3LG-FLT3-RAS-ERK signaling pathway |
| N00218 | FLT3LG-FLT3-RAS-PI3K signaling pathway |
| N00229 | TGFA-EGFR-RAS-ERK signaling pathway |
| N00230 | TGFA-overexpression to RAS-ERK signaling pathway |
| N00233 | IGF-IGF1R-RAS-ERK signaling pathway |
| N00235 | IGF2-overexpression to RAS-ERK signaling pathway |
| N00237 | IGF1R-overexpression to RAS-ERK signaling pathway |
| N00246 | HGF-overexpression to RAS-ERK signaling pathway |
| N00248 | MET-overexpression to RAS-ERK signaling pathway |
| N00252 | Amplified ERBB2 to RAS-ERK signaling pathway |
| N00259 | Amplified MET to RAS-ERK signaling pathway |
| N00276 | EGF-overexpression to RAS-ERK signaling pathway |
| N00277 | EREG-EGFR-RAS-ERK signaling pathway |
| N00278 | EREG-overexpression to RAS-ERK signaling pathway |
| N00279 | AREG-EGFR-RAS-ERK signaling pathway |
| N00280 | AREG-overexpression to RAS-ERK signaling pathway |
| N00367 | HPV E5 to EGFR-RAS-ERK signaling pathway |
| N00386 | HCMV gB to PDGFR-RAS-ERK signaling pathway |
| N00513 | Mutation-activated EGFR to RAS-ERK signaling pathway |
| N00538 | Ca2+-PYK2-RAS-ERK signaling pathway |
| N00540 | HBV HBx to RAS-ERK signaling pathway |
| N00541 | HBV HBx to RAS-ERK signaling pathway |
| N00542 | EGF-EGFR-RAS-JNK signaling pathway |
| N00994 | AGE-RAGE signaling pathway |
| N00996 | Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway |
| N01062 | Mutation-activated MET to RAS-ERK signaling pathway |
| N01064 | Mutation-activated RET to RAS-ERK signaling pathway |
| N01343 | ACH-CHRN-RAS-ERK signaling pathway |
| N01344 | NNK/NNN to RAS-ERK signaling pathway |
| N01351 | E2-ER-RAS-ERK signaling pathway |
| N01352 | BPA to RAS-ERK signaling pathway |
| N01353 | E2 to RAS-ERK signaling pathway |
| N01354 | BPA to RAS-ERK signaling pathway |
| N01360 | P4-PR-RAS-ERK signaling pathway |
| N01361 | P4/MPA to PR-RAS-ERK signaling pathway |
| N01408 | Metals to RAS-ERK signaling pathway |
| N01592 | GF-RTK-RAS-ERK signaling pathway |
| N01596 | Regulation of GF-RTK-RAS-ERK signaling, RAS ubiquitination by CUL3 complex |
| N01597 | Regulation of GF-RTK-RAS-ERK signaling, SPRED and NF1 |
| N01600 | Regulation of GF-RTK-RAS-ERK signaling, RasGAP |
| N01658 | GF-RTK-RAS-PI3K signaling pathway |
| N01874 | NRG-ERBB2/ERBB3 pathway (RAS-ERK signaling) |
| N02023 | DSG1 to Raf/MEK/ERK pathway |
|
| Disease |
| H00108 | Autoimmune lymphoproliferative syndromes |
| H00523 | Noonan syndrome and related disorders |
| H02410 | Myelodysplastic/myeloproliferative neoplasms |
| H02411 | Chronic myelomonocytic leukemia |
| H02412 | Atypical chronic myeloid leukemia |
| H02425 | Erdheim-Chester disease |
| H02541 | Juvenile myelomonocytic leukemia |
| H02628 | Schimmelpenning-Feuerstein-Mims syndrome |
| H02874 | Congenital melanocytic nevus syndrome |
| H02875 | Neurocutaneous melanosis |
|
| Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
4893 (NRAS)
04012 ErbB signaling pathway
4893 (NRAS)
04014 Ras signaling pathway
4893 (NRAS)
04015 Rap1 signaling pathway
4893 (NRAS)
04370 VEGF signaling pathway
4893 (NRAS)
04371 Apelin signaling pathway
4893 (NRAS)
04068 FoxO signaling pathway
4893 (NRAS)
04072 Phospholipase D signaling pathway
4893 (NRAS)
04071 Sphingolipid signaling pathway
4893 (NRAS)
04151 PI3K-Akt signaling pathway
4893 (NRAS)
04150 mTOR signaling pathway
4893 (NRAS)
09133 Signaling molecules and interaction
04519 Cadherin signaling
4893 (NRAS)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
4893 (NRAS)
04137 Mitophagy - animal
4893 (NRAS)
09143 Cell growth and death
04210 Apoptosis
4893 (NRAS)
04218 Cellular senescence
4893 (NRAS)
09144 Cellular community - eukaryotes
04540 Gap junction
4893 (NRAS)
04550 Signaling pathways regulating pluripotency of stem cells
4893 (NRAS)
09142 Cell motility
04810 Regulation of actin cytoskeleton
4893 (NRAS)
09150 Organismal Systems
09151 Immune system
04625 C-type lectin receptor signaling pathway
4893 (NRAS)
04650 Natural killer cell mediated cytotoxicity
4893 (NRAS)
04660 T cell receptor signaling pathway
4893 (NRAS)
04662 B cell receptor signaling pathway
4893 (NRAS)
04664 Fc epsilon RI signaling pathway
4893 (NRAS)
04062 Chemokine signaling pathway
4893 (NRAS)
09152 Endocrine system
04910 Insulin signaling pathway
4893 (NRAS)
04929 GnRH secretion
4893 (NRAS)
04912 GnRH signaling pathway
4893 (NRAS)
04915 Estrogen signaling pathway
4893 (NRAS)
04917 Prolactin signaling pathway
4893 (NRAS)
04921 Oxytocin signaling pathway
4893 (NRAS)
04926 Relaxin signaling pathway
4893 (NRAS)
04935 Growth hormone synthesis, secretion and action
4893 (NRAS)
04919 Thyroid hormone signaling pathway
4893 (NRAS)
04916 Melanogenesis
4893 (NRAS)
09156 Nervous system
04725 Cholinergic synapse
4893 (NRAS)
04726 Serotonergic synapse
4893 (NRAS)
04720 Long-term potentiation
4893 (NRAS)
04730 Long-term depression
4893 (NRAS)
04722 Neurotrophin signaling pathway
4893 (NRAS)
09158 Development and regeneration
04360 Axon guidance
4893 (NRAS)
09149 Aging
04211 Longevity regulating pathway
4893 (NRAS)
04213 Longevity regulating pathway - multiple species
4893 (NRAS)
09159 Environmental adaptation
04714 Thermogenesis
4893 (NRAS)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
4893 (NRAS)
05206 MicroRNAs in cancer
4893 (NRAS)
05205 Proteoglycans in cancer
4893 (NRAS)
05207 Chemical carcinogenesis - receptor activation
4893 (NRAS)
05208 Chemical carcinogenesis - reactive oxygen species
4893 (NRAS)
05203 Viral carcinogenesis
4893 (NRAS)
05230 Central carbon metabolism in cancer
4893 (NRAS)
05231 Choline metabolism in cancer
4893 (NRAS)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
4893 (NRAS)
09162 Cancer: specific types
05210 Colorectal cancer
4893 (NRAS)
05225 Hepatocellular carcinoma
4893 (NRAS)
05226 Gastric cancer
4893 (NRAS)
05214 Glioma
4893 (NRAS)
05216 Thyroid cancer
4893 (NRAS)
05221 Acute myeloid leukemia
4893 (NRAS)
05220 Chronic myeloid leukemia
4893 (NRAS)
05218 Melanoma
4893 (NRAS)
05211 Renal cell carcinoma
4893 (NRAS)
05219 Bladder cancer
4893 (NRAS)
05215 Prostate cancer
4893 (NRAS)
05213 Endometrial cancer
4893 (NRAS)
05224 Breast cancer
4893 (NRAS)
05223 Non-small cell lung cancer
4893 (NRAS)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
4893 (NRAS)
05170 Human immunodeficiency virus 1 infection
4893 (NRAS)
05161 Hepatitis B
4893 (NRAS)
05160 Hepatitis C
4893 (NRAS)
05163 Human cytomegalovirus infection
4893 (NRAS)
05167 Kaposi sarcoma-associated herpesvirus infection
4893 (NRAS)
05165 Human papillomavirus infection
4893 (NRAS)
09164 Neurodegenerative disease
05010 Alzheimer disease
4893 (NRAS)
05022 Pathways of neurodegeneration - multiple diseases
4893 (NRAS)
09165 Substance dependence
05034 Alcoholism
4893 (NRAS)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
4893 (NRAS)
09167 Endocrine and metabolic disease
04933 AGE-RAGE signaling pathway in diabetic complications
4893 (NRAS)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
4893 (NRAS)
01522 Endocrine resistance
4893 (NRAS)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:hsa04131]
4893 (NRAS)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:hsa04147]
4893 (NRAS)
04031 GTP-binding proteins [BR:hsa04031]
4893 (NRAS)
Membrane trafficking [BR:hsa04131]
Exocytosis
Small GTPases and associated proteins
Other small GTPases and associated proteins
4893 (NRAS)
Endocytosis
Macropinocytosis
Ras GTPases
4893 (NRAS)
Exosome [BR:hsa04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
4893 (NRAS)
Exosomal proteins of other body fluids (saliva and urine)
4893 (NRAS)
Exosomal proteins of breast cancer cells
4893 (NRAS)
Exosomal proteins of colorectal cancer cells
4893 (NRAS)
GTP-binding proteins [BR:hsa04031]
Small (monomeric) G-proteins
Ras Family
Ras [OT]
4893 (NRAS)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| Structure |
|
| LinkDB |
|
| Position |
1:complement(114704469..114716771)
|
| AA seq |
189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM |
| NT seq |
570 nt +upstreamnt +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaagtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa |