KEGG   Homo sapiens (human): 595
Entry
595               CDS       T01001                                 

Symbol
CCND1, BCL1, D11S287E, PRAD1, U21B31
Name
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04371  Apelin signaling pathway
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04630  JAK-STAT signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04936  Alcoholic liver disease
hsa05160  Hepatitis C
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05416  Viral myocarditis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06115  WNT signaling (viruses and bacteria)
nt06130  Cell cycle (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling
nt06215  WNT signaling
nt06219  JAK-STAT signaling
nt06220  Calcium signaling
nt06227  Nuclear receptor signaling
nt06230  Cell cycle G1/S
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06264  Renal cell carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00005  Mutation-activated MET to RAS-ERK signaling pathway
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00012  Mutation-activated KRAS/NRAS to ERK signaling pathway
N00014  Mutation-activated EGFR to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00024  Mutation-activated EGFR to PLCG-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00066  MDM2-p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
N00275  Amplified CCND1 to cell cycle G1/S
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
N00347  p300-p21-Cell cycle G1/S
N00483  EBV EBNA3C to cell cycle G1/S
N00510  HTLV-1 Tax to CREB-mediated transcription
N00513  Mutation-activated EGFR to RAS-ERK signaling pathway
N00529  HCV core to RXRA/PPARA-mediated transcription
N00530  HCV core to RXRA/LXRA-mediated transcription
N01342  Nicotine to Jak-STAT signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01362  Nuclear-initiated progesterone signaling pathway
Disease
H00006  Hairy cell leukemia
H00010  Multiple myeloma
H00016  Oral cancer
H00017  Esophageal cancer
H00031  Breast cancer
H00055  Laryngeal cancer
H00559  von Hippel-Lindau syndrome
H01464  Mantle cell lymphoma
Drug target
Omacetaxine mepesuccinate: D08956<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    595 (CCND1)
   04340 Hedgehog signaling pathway
    595 (CCND1)
   04390 Hippo signaling pathway
    595 (CCND1)
   04371 Apelin signaling pathway
    595 (CCND1)
   04630 JAK-STAT signaling pathway
    595 (CCND1)
   04068 FoxO signaling pathway
    595 (CCND1)
   04151 PI3K-Akt signaling pathway
    595 (CCND1)
   04152 AMPK signaling pathway
    595 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    595 (CCND1)
   04115 p53 signaling pathway
    595 (CCND1)
   04218 Cellular senescence
    595 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    595 (CCND1)
   04530 Tight junction
    595 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    595 (CCND1)
   04921 Oxytocin signaling pathway
    595 (CCND1)
   04919 Thyroid hormone signaling pathway
    595 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    595 (CCND1)
   05206 MicroRNAs in cancer
    595 (CCND1)
   05205 Proteoglycans in cancer
    595 (CCND1)
   05207 Chemical carcinogenesis - receptor activation
    595 (CCND1)
   05203 Viral carcinogenesis
    595 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    595 (CCND1)
   05212 Pancreatic cancer
    595 (CCND1)
   05225 Hepatocellular carcinoma
    595 (CCND1)
   05226 Gastric cancer
    595 (CCND1)
   05214 Glioma
    595 (CCND1)
   05216 Thyroid cancer
    595 (CCND1)
   05221 Acute myeloid leukemia
    595 (CCND1)
   05220 Chronic myeloid leukemia
    595 (CCND1)
   05218 Melanoma
    595 (CCND1)
   05219 Bladder cancer
    595 (CCND1)
   05215 Prostate cancer
    595 (CCND1)
   05213 Endometrial cancer
    595 (CCND1)
   05224 Breast cancer
    595 (CCND1)
   05222 Small cell lung cancer
    595 (CCND1)
   05223 Non-small cell lung cancer
    595 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    595 (CCND1)
   05160 Hepatitis C
    595 (CCND1)
   05162 Measles
    595 (CCND1)
   05163 Human cytomegalovirus infection
    595 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    595 (CCND1)
   05169 Epstein-Barr virus infection
    595 (CCND1)
   05165 Human papillomavirus infection
    595 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    595 (CCND1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    595 (CCND1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    595 (CCND1)
   04934 Cushing syndrome
    595 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    595 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 595
NCBI-ProteinID: NP_444284
OMIM: 168461
HGNC: 1582
Ensembl: ENSG00000110092
Vega: OTTHUMG00000167877
Pharos: P24385(Tchem)
UniProt: P24385 Q6FI00
LinkDB
Structure
PDB: 
2W96 2W9Z 2W99 2W9F

Position
11q13.3
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggaacagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgcaatgaccccgcacgatttc
attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccgccc
tccatggtggcagcggggagcgtggtggccgcagtgcaaggcctgaacctgaggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

KEGG   Homo sapiens (human): 8600
Entry
8600              CDS       T01001                                 

Symbol
TNFSF11, CD254, ODF, OPGL, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2, sOdf
Name
(RefSeq) TNF superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04917  Prolactin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
hsa05323  Rheumatoid arthritis
Network
nt06227  Nuclear receptor signaling
  Element
N01362  Nuclear-initiated progesterone signaling pathway
Disease
H00436  Osteopetrosis
H01470  Giant cell tumor of bone
Drug target
Denosumab: D03684<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    8600 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8600 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    8600 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    8600 (TNFSF11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    8600 (TNFSF11)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    8600 (TNFSF11)
  09162 Cancer: specific types
   05224 Breast cancer
    8600 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    8600 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    8600 (TNFSF11)
   04090 CD molecules [BR:hsa04090]
    8600 (TNFSF11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8600 (TNFSF11)
CD molecules [BR:hsa04090]
 Proteins
  8600 (TNFSF11)
SSDB
Motif
Pfam: TNF DisA
Other DBs
NCBI-GeneID: 8600
NCBI-ProteinID: NP_003692
OMIM: 602642
HGNC: 11926
Ensembl: ENSG00000120659
Vega: OTTHUMG00000016807
Pharos: O14788(Tclin)
UniProt: O14788 Q5T9Y4
LinkDB
Structure
PDB: 
3URF 5BNQ

Position
13q14.11
AA seq 317 aa
MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV
VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK
QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH
KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV
YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD
PDQDATYFGAFKVRDID
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcgccgcgccagcagagactacaccaagtacctgcgtggctcggaggagatgggcggc
ggccccggagccccgcacgagggccccctgcacgccccgccgccgcctgcgccgcaccag
ccccctgccgcctcccgctccatgttcgtggccctcctggggctggggctgggccaggtt
gtctgcagcgtcgccctgttcttctatttcagagcgcagatggatcctaatagaatatca
gaagatggcactcactgcatttatagaattttgagactccatgaaaatgcagattttcaa
gacacaactctggagagtcaagatacaaaattaatacctgattcatgtaggagaattaaa
caggcctttcaaggagctgtgcaaaaggaattacaacatatcgttggatcacagcacatc
agagcagagaaagcgatggtggatggctcatggttagatctggccaagaggagcaagctt
gaagctcagccttttgctcatctcactattaatgccaccgacatcccatctggttcccat
aaagtgagtctgtcctcttggtaccatgatcggggttgggccaagatctccaacatgact
tttagcaatggaaaactaatagttaatcaggatggcttttattacctgtatgccaacatt
tgctttcgacatcatgaaacttcaggagacctagctacagagtatcttcaactaatggtg
tacgtcactaaaaccagcatcaaaatcccaagttctcataccctgatgaaaggaggaagc
accaagtattggtcagggaattctgaattccatttttattccataaacgttggtggattt
tttaagttacggtctggagaggaaatcagcatcgaggtctccaacccctccttactggat
ccggatcaggatgcaacatactttggggcttttaaagttcgagatatagattga

KEGG   Homo sapiens (human): 54361
Entry
54361             CDS       T01001                                 

Symbol
WNT4, SERKAL, WNT-4
Name
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04919  Thyroid hormone signaling pathway
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01362  Nuclear-initiated progesterone signaling pathway
Disease
H00600  Mullerian agenesis
H02317  SERKAL syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    54361 (WNT4)
   04390 Hippo signaling pathway
    54361 (WNT4)
   04150 mTOR signaling pathway
    54361 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    54361 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    54361 (WNT4)
   04916 Melanogenesis
    54361 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    54361 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54361 (WNT4)
   05205 Proteoglycans in cancer
    54361 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    54361 (WNT4)
   05226 Gastric cancer
    54361 (WNT4)
   05217 Basal cell carcinoma
    54361 (WNT4)
   05224 Breast cancer
    54361 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    54361 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54361 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    54361 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    54361 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    54361 (WNT4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   54361 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 54361
NCBI-ProteinID: NP_110388
OMIM: 603490
HGNC: 12783
Ensembl: ENSG00000162552
Vega: OTTHUMG00000002894
Pharos: P56705(Tbio)
UniProt: P56705
LinkDB
Position
1p36.12
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagtccccgctcgtgcctgcgttcgctgcgcctcctcgtcttcgccgtcttctcagcc
gccgcgagcaactggctgtacctggccaagctgtcgtcggtggggagcatctcagaggag
gagacgtgcgagaaactcaagggcctgatccagaggcaggtgcagatgtgcaagcggaac
ctggaagtcatggactcggtgcgccgcggtgcccagctggccattgaggagtgccagtac
cagttccggaaccggcgctggaactgctccacactcgactccttgcccgtcttcggcaag
gtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcggcaggtgtg
gcctttgcagtgacgcgggcgtgcagcagtggggagctggagaagtgcggctgtgacagg
acagtgcatggggtcagcccacagggcttccagtggtcaggatgctctgacaacatcgcc
tacggtgtggccttctcacagtcgtttgtggatgtgcgggagagaagcaagggggcctcg
tccagcagagccctcatgaacctccacaacaatgaggccggcaggaaggccatcctgaca
cacatgcgggtggaatgcaagtgccacggggtgtcaggctcctgtgaggtaaagacgtgc
tggcgagccgtgccgcccttccgccaggtgggtcacgcactgaaggagaagtttgatggt
gccactgaggtggagccacgccgcgtgggctcctccagggcactggtgccacgcaacgca
cagttcaagccgcacacagatgaggacctggtgtacttggagcctagccccgacttctgt
gagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacatgcaacaagacgtcc
aaggccatcgacggctgtgagctgctgtgctgtggccgcggcttccacacggcgcaggtg
gagctggctgaacgctgcagctgcaaattccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagttgcacacgtgccgatga

KEGG   Homo sapiens (human): 6387
Entry
6387              CDS       T01001                                 

Symbol
CXCL12, IRH, PBSF, SCYB12, SDF1, TLSF, TPAR1, SDF1A, SDF1B
Name
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04360  Axon guidance
hsa04670  Leukocyte transendothelial migration
hsa04672  Intestinal immune network for IgA production
hsa04810  Regulation of actin cytoskeleton
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
hsa05323  Rheumatoid arthritis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06227  Nuclear receptor signaling
nt06263  Hepatocellular carcinoma
  Element
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
N01247  CXCL12 to CXCR4/7 signaling
N01248  VAV CrmB to CXCR signaling
N01249  HSV1 SgG1 to CXCR signaling
N01250  HSV2 SgG2 to CXCR signaling
N01251  CXCL12 to KSHV vGPCR signaling
N01362  Nuclear-initiated progesterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6387 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6387 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6387 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6387 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    6387 (CXCL12)
   04672 Intestinal immune network for IgA production
    6387 (CXCL12)
   04062 Chemokine signaling pathway
    6387 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    6387 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6387 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6387 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6387 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6387 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6387 (CXCL12)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6387 (CXCL12)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6387 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6387
NCBI-ProteinID: NP_000600
OMIM: 600835
HGNC: 10672
Ensembl: ENSG00000107562
Vega: OTTHUMG00000018054
Pharos: P48061(Tbio)
UniProt: P48061
LinkDB
Structure
PDB: 

Position
10q11.21
AA seq 93 aa
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaacgccaaggtcgtggtcgtgctggtcctcgtgctgaccgcgctctgcctcagcgac
gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc
agagccaacgtcaagcatctcaaaattctcaacactccaaactgtgcccttcagattgta
gcccggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag
gagtacctggagaaagctttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system