KEGG   Homo sapiens (human): 5241
Entry
5241              CDS       T01001                                 
Symbol
PGR, NR3C3, PR
Name
(RefSeq) progesterone receptor
  KO
K08556  progesterone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
N01358  P4-PR-PI3K signaling pathway
N01359  P4/MPA to PR-PI3K signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01362  Nuclear-initiated progesterone signaling pathway
N01363  P4/MPA to nuclear-initiated progesterone signaling pathway
Disease
H00031  Breast cancer
Drug target
Aglepristone: D07096
Allylestrenol: D01374
Altrenogest: D02840
Amadinone acetate: D02881
Asoprisnil: D02996
Chlormadinone (DG00469): D01299<JP> D07670
Danazol: D00289<JP/US>
Demegestone: D07223
Desogestrel: D02367
Dienogest: D03799<JP>
Drospirenone: D03917<US>
Dydrogesterone: D01217<JP>
Ethylestrenol: D01414
Etonogestrel: D04104<US>
Etynodiol (DG00470): D01294 D07939
Flugestone: D07968
Gestaclone: D04315
Gestodene: D04316
Gestonorone: D01159<JP>
Hydroxyprogesterone (DG00467): D00949<JP/US> D08052 D08053
Levonorgestrel: D00950<JP/US>
Lonaprisan: D10016
Lynestrenol: D01580
Medrogestone: D04885
Medroxyprogesterone (DG00458): D00951<JP/US> D08166
Megestrol (DG00457): D00952<US> D08167
Methynodiol diacetate: D05003
Metogest: D05009
Mifepristone: D00585<US>
Nomegestrol (DG00468): D07222 D08281
Norelgestromin: D05205
Norethisterone (DG00456): D00182<JP/US> D00953<US> D08285
Norethynodrel: D05207
Norgestimate: D05209
Norgestrel: D00954
Norgestrienone: D07220
Onapristone: D09571
Oxogestone phenpropionate: D05308
Progesterone: D00066<JP/US>
Proligestone: D08429
Promegestone: D08431
Quingestanol: D05679
Quingestrone: D05680
Segesterone (DG02828): D10986 D10987
Tanaproget: D06003
Telapristone acetate: D09972
Tigestol: D06145
Tosagestin: D06197
Trimegestone: D06235
Ulipristal (DG00459): D09567 D09687<US>
Vilaprisan: D11181
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5241 (PGR)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    5241 (PGR)
   04914 Progesterone-mediated oocyte maturation
    5241 (PGR)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    5241 (PGR)
  09162 Cancer: specific types
   05224 Breast cancer
    5241 (PGR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5241 (PGR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    5241 (PGR)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    5241 (PGR)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   5241 (PGR)
SSDB
Motif
Pfam: Prog_receptor Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 5241
NCBI-ProteinID: NP_000917
OMIM: 607311
HGNC: 8910
Ensembl: ENSG00000082175
Vega: OTTHUMG00000167531
Pharos: P06401(Tclin)
UniProt: P06401
Structure
LinkDB
Position
11:complement(101029624..101129813)
AA seq 933 aa
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgactgagctgaaggcaaagggtccccgggctccccacgtggcgggcggcccgccctcc
cccgaggtcggatccccactgctgtgtcgcccagccgcaggtccgttcccggggagccag
acctcggacaccttgcctgaagtttcggccatacctatctccctggacgggctactcttc
cctcggccctgccagggacaggacccctccgacgaaaagacgcaggaccagcagtcgctg
tcggacgtggagggcgcatattccagagctgaagctacaaggggtgctggaggcagcagt
tctagtcccccagaaaaggacagcggactgctggacagtgtcttggacactctgttggcg
ccctcaggtcccgggcagagccaacccagccctcccgcctgcgaggtcaccagctcttgg
tgcctgtttggccccgaacttcccgaagatccaccggctgcccccgccacccagcgggtg
ttgtccccgctcatgagccggtccgggtgcaaggttggagacagctccgggacggcagct
gcccataaagtgctgccccggggcctgtcaccagcccggcagctgctgctcccggcctct
gagagccctcactggtccggggccccagtgaagccgtctccgcaggccgctgcggtggag
gttgaggaggaggatggctctgagtccgaggagtctgcgggtccgcttctgaagggcaaa
cctcgggctctgggtggcgcggcggctggaggaggagccgcggctgtcccgccgggggcg
gcagcaggaggcgtcgccctggtccccaaggaagattcccgcttctcagcgcccagggtc
gccctggtggagcaggacgcgccgatggcgcccgggcgctccccgctggccaccacggtg
atggatttcatccacgtgcctatcctgcctctcaatcacgccttattggcagcccgcact
cggcagctgctggaagacgaaagttacgacggcggggccggggctgccagcgcctttgcc
ccgccgcggagttcaccctgtgcctcgtccaccccggtcgctgtaggcgacttccccgac
tgcgcgtacccgcccgacgccgagcccaaggacgacgcgtaccctctctatagcgacttc
cagccgcccgctctaaagataaaggaggaggaggaaggcgcggaggcctccgcgcgctcc
ccgcgttcctaccttgtggccggtgccaaccccgcagccttcccggatttcccgttgggg
ccaccgcccccgctgccgccgcgagcgaccccatccagacccggggaagcggcggtgacg
gccgcacccgccagtgcctcagtctcgtctgcgtcctcctcggggtcgaccctggagtgc
atcctgtacaaagcggagggcgcgccgccccagcagggcccgttcgcgccgccgccctgc
aaggcgccgggcgcgagcggctgcctgctcccgcgggacggcctgccctccacctccgcc
tctgccgccgccgccggggcggcccccgcgctctaccctgcactcggcctcaacgggctc
ccgcagctcggctaccaggccgccgtgctcaaggagggcctgccgcaggtctacccgccc
tatctcaactacctgaggccggattcagaagccagccagagcccacaatacagcttcgag
tcattacctcagaagatttgtttaatctgtggggatgaagcatcaggctgtcattatggt
gtccttacctgtgggagctgtaaggtcttctttaagagggcaatggaagggcagcacaac
tacttatgtgctggaagaaatgactgcatcgttgataaaatccgcagaaaaaactgccca
gcatgtcgccttagaaagtgctgtcaggctggcatggtccttggaggtcgaaaatttaaa
aagttcaataaagtcagagttgtgagagcactggatgctgttgctctcccacagccagtg
ggcgttccaaatgaaagccaagccctaagccagagattcactttttcaccaggtcaagac
atacagttgattccaccactgatcaacctgttaatgagcattgaaccagatgtgatctat
gcaggacatgacaacacaaaacctgacacctccagttctttgctgacaagtcttaatcaa
ctaggcgagaggcaacttctttcagtagtcaagtggtctaaatcattgccaggttttcga
aacttacatattgatgaccagataactctcattcagtattcttggatgagcttaatggtg
tttggtctaggatggagatcctacaaacacgtcagtgggcagatgctgtattttgcacct
gatctaatactaaatgaacagcggatgaaagaatcatcattctattcattatgccttacc
atgtggcagatcccacaggagtttgtcaagcttcaagttagccaagaagagttcctctgt
atgaaagtattgttacttcttaatacaattcctttggaagggctacgaagtcaaacccag
tttgaggagatgaggtcaagctacattagagagctcatcaaggcaattggtttgaggcaa
aaaggagttgtgtcgagctcacagcgtttctatcaacttacaaaacttcttgataacttg
catgatcttgtcaaacaacttcatctgtactgcttgaatacatttatccagtcccgggca
ctgagtgttgaatttccagaaatgatgtctgaagttattgctgcacaattacccaagata
ttggcagggatggtgaaaccccttctctttcataaaaagtga

KEGG   Homo sapiens (human): 6714
Entry
6714              CDS       T01001                                 
Symbol
SRC, ASV, SRC1, THC6, c-SRC, p60-Src
Name
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04137  Mitophagy - animal
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04613  Neutrophil extracellular trap formation
hsa04625  C-type lectin receptor signaling pathway
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05219  Bladder cancer
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06223  TNF signaling
nt06230  Cell cycle
nt06263  Hepatocellular carcinoma
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01079  Shigella IpaC to Actin signaling pathway
N01091  Escherichia EspJ to IGG-FCGR-RAC signaling pathway
N01336  CHRNA7-E2F signaling pathway
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
N01352  BPA to RAS-ERK signaling pathway
N01353  E2 to RAS-ERK signaling pathway
N01358  P4-PR-PI3K signaling pathway
N01359  P4/MPA to PR-PI3K signaling pathway
N01360  P4-PR-RAS-ERK signaling pathway
N01361  P4/MPA to PR-RAS-ERK signaling pathway
N01411  Metals to NFKB signaling pathway
Disease
H00978  Thrombocytopenia (THC)
Drug target
Bosutinib (DG00718): D03252 D09728<JP/US>
Dasatinib (DG00714): D03658<JP> D06414<JP/US>
Ilorasertib: D10423
Saracatinib (DG01418): D09664 D09665
Tirbanibulin (DG03082): D11691<US> D11692
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    6714 (SRC)
   04015 Rap1 signaling pathway
    6714 (SRC)
   04370 VEGF signaling pathway
    6714 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6714 (SRC)
   04137 Mitophagy - animal
    6714 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    6714 (SRC)
   04520 Adherens junction
    6714 (SRC)
   04530 Tight junction
    6714 (SRC)
   04540 Gap junction
    6714 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6714 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6714 (SRC)
   04613 Neutrophil extracellular trap formation
    6714 (SRC)
   04625 C-type lectin receptor signaling pathway
    6714 (SRC)
   04062 Chemokine signaling pathway
    6714 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6714 (SRC)
   04915 Estrogen signaling pathway
    6714 (SRC)
   04917 Prolactin signaling pathway
    6714 (SRC)
   04921 Oxytocin signaling pathway
    6714 (SRC)
   04926 Relaxin signaling pathway
    6714 (SRC)
   04919 Thyroid hormone signaling pathway
    6714 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    6714 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6714 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    6714 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6714 (SRC)
   05207 Chemical carcinogenesis - receptor activation
    6714 (SRC)
   05208 Chemical carcinogenesis - reactive oxygen species
    6714 (SRC)
   05203 Viral carcinogenesis
    6714 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    6714 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    6714 (SRC)
   05168 Herpes simplex virus 1 infection
    6714 (SRC)
   05163 Human cytomegalovirus infection
    6714 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6714 (SRC)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6714 (SRC)
   05130 Pathogenic Escherichia coli infection
    6714 (SRC)
   05131 Shigellosis
    6714 (SRC)
   05135 Yersinia infection
    6714 (SRC)
   05152 Tuberculosis
    6714 (SRC)
   05100 Bacterial invasion of epithelial cells
    6714 (SRC)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6714 (SRC)
   05418 Fluid shear stress and atherosclerosis
    6714 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    6714 (SRC)
   01522 Endocrine resistance
    6714 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6714 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6714 (SRC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6714 (SRC)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   6714 (SRC)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    6714 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    6714 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    6714 (SRC)
  Macropinocytosis
   Kinases
    6714 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 ABC1 SH3_10 Haspin_kinase SH3_3
Other DBs
NCBI-GeneID: 6714
NCBI-ProteinID: NP_005408
OMIM: 190090
HGNC: 11283
Ensembl: ENSG00000197122
Vega: OTTHUMG00000032417
Pharos: P12931(Tclin)
UniProt: P12931
Structure
LinkDB
Position
20:37344699..37406050
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatcgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtacgtg
gagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggcggactttgggctggctcggctcattgaagacaatgagtacacg
gcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtccttcgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

DBGET integrated database retrieval system