KEGG   Homo sapiens (human): 6328Help
Entry
6328              CDS       T01001                                 

Gene name
SCN3A, EIEE62, FFEVF4, NAC3, Nav1.3
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 3
  KO
K04836  voltage-gated sodium channel type III alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04742  Taste transduction
Disease
H00606  Early infantile epileptic encephalopathy
H02214  Familial focal epilepsy with variable foci
Drug target
Actisomide: D02762
Ajmaline: D00199
Aminobenzoic acid (DG00379): D02456 D02906 D02907
Amiodarone (DG00204): D00636 D02910
Aprindine (DG00199): D01326 D02969
Articaine (DG00805): D02991 D07468
Benzocaine: D00552
Bupivacaine (DG00801): D01450 D07552
Carbamazepine: D00252
Chloroprocaine (DG00800): D00732 D07678
Cibenzoline (DG00209): D01455 D03492
Cinchocaine (DG00297): D00733 D02220
Cocaine (DG00808): D00110 D02182
Disopyramide (DG00194): D00303 D00637
Eleclazine: D11155
Encainide (DG00203): D03991 D07894
Eslicarbazepine (DG00848): D09215 D09612
Ethyl piperidinoacetylaminobenzoate: D01519
Etidocaine (DG00804): D00737 D04095
Flecainide (DG00201): D00638 D07962
Fosphenytoin (DG00847): D02096 D07595 D07993
Indecainide hydrochloride: D04521
Lacosamide: D07299
Lamotrigine: D00354
Levobupivacaine (DG00807): D01287 D08116
Levosemotiadil fumarate: D09833
Lidocaine (DG00196): D00358 D02086 D08127
Lorajmine: D04774
Mephenytoin: D00375
Mepivacaine (DG00802): D00738 D08181
Mexiletine (DG00197): D00639 D08215
Oxcarbazepine: D00533
Oxetacaine (DG00299): D01152 D08311
Oxybuprocaine (DG00392): D01768 D08319
Phenytoin (DG00846): D00512 D02103
Pilsicainide (DG01257): D01554 D08377
Pirmenol (DG01381): D01785 D06517 D08394
Pramocaine (DG00300): D00739 D08407
Prilocaine (DG00803): D00553 D01243
Procainamide (DG00193): D00477 D08421
Procaine (DG00298): D00740 D08422
Propafenone (DG00200): D00640 D08435
Proxymetacaine (DG01145): D02098 D08448
Quinidine (DG00192): D00642 D00643 D02272 D08458 D08459
Recainam (DG01421): D05708 D05709
Ropivacaine (DG00806): D04048 D08490
Rufinamide: D05775
Sparteine (DG00195): D01041 D02239
Tetracaine (DG00296): D00551 D00741
Tocainide (DG00198): D02088 D06172
Topiramate: D00537
Transcainide: D06203
Zonisamide: D00538
p-Butylaminobenzoyldiethylaminoethyl hydrochloride: D01967
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    6328 (SCN3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    6328 (SCN3A)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   6328 (SCN3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_cytopl Na_trans_assoc PKD_channel GPHH ATP-synt_B IQ Lustrin_cystein
Motif
Other DBs
NCBI-GeneID: 6328
NCBI-ProteinID: NP_008853
OMIM: 182391
HGNC: 10590
Ensembl: ENSG00000153253
Vega: OTTHUMG00000044171
Pharos: Q9NY46(Tclin)
UniProt: Q9NY46
LinkDB All DBs
Position
2q24.3
AA seq 2000 aa AA seqDB search
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVGGP
SALTSPTGQLPPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAVSIASILTNTMEELE
ESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELG
LSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKN
KMRECFQKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNGTTSGVGTGSSV
EKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSSSE
GSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRKTCY
SIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWV
AYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEG
MRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFDISDVNN
LSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEE
NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMTLVLSR
INLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLF
RVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV
KKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGSSVKGD
CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKF
DPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRV
LGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRL
KNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEK
FEKDKPEKESKGKEVRENQK
NT seq 6003 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcactgttggtacccccaggacctgaaagcttccgcctttttactagagaa
tctcttgctgctatcgaaaaacgtgctgcagaagagaaagccaagaagcccaaaaaggaa
caagataatgatgatgagaacaaaccaaagccaaatagtgacttggaagctggaaagaac
cttccatttatttatggagacattcctccagagatggtgtcagagcccctggaggacctg
gatccctactatatcaataagaaaacttttatagtaatgaataaaggaaaggcaattttc
cgattcagtgccacctctgccttgtatattttaactccactaaaccctgttaggaaaatt
gctatcaagattttggtacattctttattcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgaccttgagcaaccctcctgactggacaaagaatgtagagtacaca
ttcactggaatctatacctttgagtcacttataaaaatcttggcaagagggttttgctta
gaagattttacgtttcttcgtgatccatggaactggctggatttcagtgtcattgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgttgagaacattcagagtt
ctccgagcactgaaaacaatttcagtcattccaggtttaaagaccattgtgggggccctg
atccagtcggtaaagaagctttctgatgtgatgatcctgactgtgttctgtctgagcgtg
tttgctctcattgggctgcagctgttcatgggcaatctgaggaataaatgtttgcagtgg
cccccaagcgattctgcttttgaaaccaacaccacttcctactttaatggcacaatggat
tcaaatgggacatttgttaatgtaacaatgagcacatttaactggaaggattacattgga
gatgacagtcacttttatgttttggatgggcaaaaagaccctttactctgtggaaatggc
tcagatgcaggccagtgtccagaaggatacatctgtgtgaaggctggtcgaaaccccaac
tatggctacacaagctttgacacctttagctgggctttcctgtctctatttcgactcatg
actcaagactactgggaaaatctttaccagttgacattacgtgctgctgggaaaacatac
atgatattttttgtcctggtcattttcttgggctcattttatttggtgaatttgatcctg
gctgtggtggccatggcctatgaggagcagaatcaggccaccttggaagaagcagaacaa
aaagaggccgaatttcagcagatgctcgaacagcttaaaaagcaacaggaagaagctcag
gcagttgcggcagcatcagctgcttcaagagatttcagtggaataggtgggttaggagag
ctgttggaaagttcttcagaagcatcaaagttgagttccaaaagtgctaaagaatggagg
aaccgaaggaagaaaagaagacagagagagcaccttgaaggaaacaacaaaggagagaga
gacagctttcccaaatccgaatctgaagacagcgtcaaaagaagcagcttccttttctcc
atggatggaaacagactgaccagtgacaaaaaattctgctcccctcatcagtctctcttg
agtatccgtggctccctgttttccccaagacgcaatagcaaaacaagcattttcagtttc
agaggtcgggcaaaggatgttggatctgaaaatgactttgctgatgatgaacacagcaca
tttgaagacagcgaaagcaggagagactcactgtttgtgccgcacagacatggagagcga
cgcaacagtaacgttagtcaggccagtatgtcatccaggatggtgccagggcttccagca
aatgggaagatgcacagcactgtggattgcaatggtgtggtttccttggtgggtggacct
tcagctctaacgtcacctactggacaacttcccccagagggcaccaccacagaaacggaa
gtcagaaagagaaggttaagctcttaccagatttcaatggagatgctggaggattcctct
ggaaggcaaagagccgtgagcatagccagcattctgaccaacacaatggaagaacttgaa
gaatctagacagaaatgtccgccatgctggtatagatttgccaatgtgttcttgatctgg
gactgctgtgatgcatggttaaaagtaaaacatcttgtgaatttaattgttatggatcca
tttgttgatcttgccatcactatttgcattgtcttaaataccctctttatggccatggag
cactaccccatgactgagcaattcagtagtgtgttgactgtaggaaacctggtctttact
gggattttcacagcagaaatggttctcaagatcattgccatggatccttattactatttc
caagaaggctggaatatctttgatggaattattgtcagcctcagtttaatggagcttggt
ctgtcaaatgtggagggattgtctgtactgcgatcattcagactgcttagagttttcaag
ttggcaaaatcctggcccacactaaatatgctaattaagatcattggcaattctgtgggg
gctctaggaaacctcaccttggtgttggccatcatcgtcttcatttttgctgtggtcggc
atgcagctctttggtaagagctacaaagaatgtgtctgcaagatcaatgatgactgtacg
ctcccacggtggcacatgaacgacttcttccactccttcctgattgtgttccgcgtgctg
tgtggagagtggatagagaccatgtgggactgtatggaggtcgctggccaaaccatgtgc
cttattgttttcatgttggtcatggtcattggaaaccttgtggttctgaacctctttctg
gccttattgttgagttcatttagctcagacaaccttgctgctactgatgatgacaatgaa
atgaataatctgcagattgcagtaggaagaatgcaaaagggaattgattatgtgaaaaat
aagatgcgggagtgtttccaaaaagccttttttagaaagccaaaagttatagaaatccat
gaaggcaataagatagacagctgcatgtccaataatactggaattgaaataagcaaagag
cttaattatcttagagatgggaatggaaccaccagtggtgtaggtactggaagcagtgtt
gaaaaatacgtaatcgatgaaaatgattatatgtcattcataaacaaccccagcctcacc
gtcacagtgccaattgctgttggagagtctgactttgaaaacttaaatactgaagagttc
agcagtgagtcagaactagaagaaagcaaagagaaattaaatgcaaccagctcatctgaa
ggaagcacagttgatgttgttctaccccgagaaggtgaacaagctgaaactgaacccgaa
gaagaccttaaaccggaagcttgttttactgaaggatgtattaaaaagtttccattctgt
caagtaagtacagaagaaggcaaagggaagatctggtggaatcttcgaaaaacctgctac
agtattgttgagcacaactggtttgagactttcattgtgttcatgatccttctcagtagt
ggtgcattggcctttgaagatatatacattgaacagcgaaagactatcaaaaccatgcta
gaatatgctgacaaagtctttacctatatattcattctggaaatgcttctcaaatgggtt
gcttatggatttcaaacatatttcactaatgcctggtgctggctagatttcttgatcgtt
gatgtttctttggttagcctggtagccaatgctcttggctactcagaactcggtgccatc
aaatcattacggacattaagagctttaagacctctaagagccttatcccggtttgaaggc
atgagggtggttgtgaatgctcttgttggagcaattccctctatcatgaatgtgctgttg
gtctgtctcatcttctggttgatctttagcatcatgggtgtgaatttgtttgctggcaag
ttctaccactgtgttaacatgacaacgggtaacatgtttgacattagtgatgttaacaat
ttgagtgactgtcaggctcttggcaagcaagctcggtggaaaaacgtgaaagtaaacttt
gataatgttggcgctggctatcttgcactgcttcaagtggccacatttaaaggctggatg
gatattatgtatgcagctgttgattcacgagatgttaaacttcagcctgtatatgaagaa
aatctgtacatgtatttatactttgtcatctttatcatctttgggtcattcttcactctg
aatctattcattggtgtcatcatagataacttcaaccagcagaaaaagaagtttggaggt
caagacatctttatgacagaggaacagaaaaaatattacaatgcaatgaagaaacttgga
tccaagaaacctcagaaacccatacctcgcccagcaaacaaattccaaggaatggtcttt
gattttgtaaccagacaagtctttgatatcagcatcatgatcctcatctgcctcaacatg
gtcaccatgatggtggaaacggatgaccagggcaaatacatgaccctagttttgtcccgg
atcaacctagtgttcattgttctgttcactggagaatttgtgctgaagctcgtctccctc
agacactactacttcactataggctggaacatctttgactttgtggtggtgattctctcc
attgtaggtatgtttctggctgagatgatagaaaagtattttgtgtcccctaccttgttc
cgagtgatccgtcttgccaggattggccgaatcctacgtctgatcaaaggagcaaagggg
atccgcacgctgctctttgctttgatgatgtcccttcctgcgttgtttaacatcggcctc
ctgctcttcctggtcatgtttatctatgccatctttgggatgtccaactttgcctatgtt
aaaaaggaagctggaattgatgacatgttcaactttgagacctttggcaacagcatgatc
tgcttgttccaaattacaacctctgctggctgggatggattgctagcacctattcttaat
agtgcaccacccgactgtgaccctgacacaattcaccctggcagctcagttaagggagac
tgtgggaacccatctgttgggattttcttttttgtcagttacatcatcatatccttcctg
gttgtggtgaacatgtacatcgcggtcatcctggagaacttcagtgttgctactgaagaa
agtgcagagcccctgagtgaggatgactttgagatgttctatgaggtttgggaaaagttt
gatcccgatgcgacccagtttatagagttctctaaactctctgattttgcagctgccctg
gatcctcctcttctcatagcaaaacccaacaaagtccagcttattgccatggatctgccc
atggtcagtggtgaccggatccactgtcttgatattttatttgcctttacaaagcgtgtt
ttgggtgagagtggagagatggatgcccttcgaatacagatggaagacaggtttatggca
tcaaacccctccaaagtctcttatgagcctattacaaccactttgaaacgtaaacaagag
gaggtgtctgccgctatcattcagcgtaatttcagatgttatcttttaaagcaaaggtta
aaaaatatatcaagtaactataacaaagaggcaattaaagggaggattgacttacctata
aaacaagacatgattattgacaaactaaatgggaactccactccagaaaaaacagatggg
agttcctctaccacctctcctccttcctatgatagtgtaacaaaaccagacaaggaaaag
tttgagaaagacaaaccagaaaaagaaagcaaaggaaaagaggtcagagaaaatcaaaag
taa

DBGET integrated database retrieval system