KEGG   Homo sapiens (human): 2475
Entry
2475              CDS       T01001                                 
Symbol
MTOR, FRAP, FRAP1, FRAP2, RAFT1, RAPT1, SKS
Name
(RefSeq) mechanistic target of rapamycin kinase
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04371  Apelin signaling pathway
hsa04613  Neutrophil extracellular trap formation
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa04714  Thermogenesis
hsa04910  Insulin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04935  Growth hormone synthesis, secretion and action
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05415  Diabetic cardiomyopathy
Network
nt06114  PI3K signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06214  PI3K signaling
nt06224  CXCR signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06270  Breast cancer
nt06273  Glioma
nt06275  Acute myeloid leukemia
nt06415  PI3K signaling
nt06462  Spinocerebellar ataxia
  Element
N00034  ERBB2-overexpression to PI3K signaling pathway
N00035  Amplified EGFR to PI3K signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N00038  Amplified FGFR to PI3K signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00040  Amplified PDGFR to PI3K signaling pathway
N00042  EGFR-overexpression to PI3K signaling pathway
N00045  KITLG-KIT-PI3K signaling pathway
N00049  Mutation-activated PI3K to PI3K signaling pathway
N00050  Amplified PI3K to PI3K signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00159  KSHV K1 to PI3K signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00231  TGFA-EGFR-PI3K signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00260  Amplified MET to PI3K signaling pathway
N00282  EREG-EGFR-PI3K signaling pathway
N00284  AREG-EGFR-PI3K signaling pathway
N00357  HPV E6 to MTOR signaling pathway
N00385  HCMV gB to PDGFR-PI3K signaling pathway
N00387  HCMV IE1-72/IE2-86 to PI3K signaling pathway
N00388  HCMV UL38 to MTOR signaling pathway
N00582  IGF-IGF1R-PI3K signaling pathway
N00583  HSV VP11/12 to PI3K signaling pathway
N00584  HSV US3 to MTOR signaling pathway
N00963  RELN-VLDLR-PI3K signaling pathway
N01063  Mutation-activated MET to PI3K signaling pathway
N01065  Mutation-activated RET to PI3K signaling pathway
N01339  NNK/NNN to PI3K signaling pathway
N01355  Arsenic to PI3K signaling pathway
Disease
H01928  Smith-Kingsmore syndrome
Drug target
Apitolisib: D10543
Bimiralisib: D11440
Dactolisib (DG01826): D10552 D10616
Everolimus: D02714<JP/US>
Gedatolisib: D10635
Olcorolimus: D10076
Omipalisib: D10718
Onatasertib: D11663
Paxalisib: D11869
Ridaforolimus: D08900
Samotolisib: D11501
Sirolimus: D00753<JP/US>
Temsirolimus: D06068<JP/US>
Voxtalisib: D11727
Zotarolimus: D06669
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    2475 (MTOR)
   04371 Apelin signaling pathway
    2475 (MTOR)
   04630 JAK-STAT signaling pathway
    2475 (MTOR)
   04066 HIF-1 signaling pathway
    2475 (MTOR)
   04072 Phospholipase D signaling pathway
    2475 (MTOR)
   04151 PI3K-Akt signaling pathway
    2475 (MTOR)
   04152 AMPK signaling pathway
    2475 (MTOR)
   04150 mTOR signaling pathway
    2475 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    2475 (MTOR)
   04136 Autophagy - other
    2475 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    2475 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    2475 (MTOR)
   04659 Th17 cell differentiation
    2475 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    2475 (MTOR)
   04920 Adipocytokine signaling pathway
    2475 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    2475 (MTOR)
   04919 Thyroid hormone signaling pathway
    2475 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    2475 (MTOR)
   04213 Longevity regulating pathway - multiple species
    2475 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    2475 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2475 (MTOR)
   05206 MicroRNAs in cancer
    2475 (MTOR)
   05205 Proteoglycans in cancer
    2475 (MTOR)
   05207 Chemical carcinogenesis - receptor activation
    2475 (MTOR)
   05230 Central carbon metabolism in cancer
    2475 (MTOR)
   05231 Choline metabolism in cancer
    2475 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    2475 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    2475 (MTOR)
   05212 Pancreatic cancer
    2475 (MTOR)
   05225 Hepatocellular carcinoma
    2475 (MTOR)
   05226 Gastric cancer
    2475 (MTOR)
   05214 Glioma
    2475 (MTOR)
   05221 Acute myeloid leukemia
    2475 (MTOR)
   05215 Prostate cancer
    2475 (MTOR)
   05224 Breast cancer
    2475 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2475 (MTOR)
   05168 Herpes simplex virus 1 infection
    2475 (MTOR)
   05163 Human cytomegalovirus infection
    2475 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    2475 (MTOR)
   05165 Human papillomavirus infection
    2475 (MTOR)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    2475 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2475 (MTOR)
   05014 Amyotrophic lateral sclerosis
    2475 (MTOR)
   05016 Huntington disease
    2475 (MTOR)
   05017 Spinocerebellar ataxia
    2475 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    2475 (MTOR)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    2475 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    2475 (MTOR)
   04931 Insulin resistance
    2475 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2475 (MTOR)
   01522 Endocrine resistance
    2475 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2475 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2475 (MTOR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2475 (MTOR)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   2475 (MTOR)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    2475 (MTOR)
   mTORC2 complex
    2475 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD UME V-ATPase_H_N TPR_19 EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 2475
NCBI-ProteinID: NP_004949
OMIM: 601231
HGNC: 3942
Ensembl: ENSG00000198793
Pharos: P42345(Tclin)
UniProt: P42345
Structure
LinkDB
Position
1:complement(11106535..11262551)
AA seq 2549 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagc
gtcctgcagcagtttgccagtggcctaaagagccggaatgaggaaaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccaactgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagctagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgtcttgccatggcaggggacactttt
accgctgagtacgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacatgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcaacccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtagccgcccttcgtgcctgtctgattctcaca
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaagggatttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgttgatccttaacgagctggtccgaatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagtttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttgggacctcccccagtccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtatctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcggccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttgcctcgcgtgctggacatcatccga
gcggccctgcccccaaaggacttcgcccataagaggcagaaggcaatgcaggtggatgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactaagccctgccctcactgcagtg
ctctacgacctgagccgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtccctggtccttatgcacaaaccccttcgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaggctgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagaccgcagtgcaagtggtggcagatgtgcttagcaaactgctc
gtagttgggataacagatcctgaccctgacattcgctactgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccctgcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ttggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggattcctctttgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaggtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccttacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggtcaacatgggaaac
ttgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcatcatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaaatgtgtgcagttcctgccccaggtcatgcccacgttccttaacgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagcccaggccgcattgtctctatcaagttactggctgcaatc
cagctgtttggcgccaacctggatgactacctgcatttactgctgcctcctattgttaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcactt
gtttttcagctggggaagaagtaccaaattttcattccaatggtgaataaagttctggtg
cgacaccgaatcaatcatcagcgctatgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcggatgcttaggagtggc
caaggggatgcattggctagtggaccagtggaaacaggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggcgctgccaggagggtctccaaagatgactgg
ctggaatggctgagacggctgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctcttcaatgct
gcatttgtgtcctgctggtctgaactgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcacgagtgggaggatgccctt
gtggcctatgacaagaaaatggacaccaacaaggacgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcatgaagacatgagaacctggctcaagtatgcaagcctgtgc
ggcaagagtggcaggctggctcttgctcataaaactttagtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagtgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcctgaaacttggagagtggcagctgaat
ctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagct
gtgctacactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgtcatgcc
agcggggccaacatcaccaacgccaccactgccgccaccacggccgccactgccaccacc
actgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgagaacagcccc
accccatcgccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtac
acggtgcctgccgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtcaat
gaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatacgcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctacccactgacagtggcttct
aagtctaccacgacagcccggcacaatgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgtttgtactttggg
gaaaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggcccccagactctgaaggaaacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatccaagcagaggccccggaaattgacacttatgggcagcaacggacat
gagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaacacccttctggccaatgacccaacatctcttcggaaaaacctc
agcatccagagatacgctgtcatccctttatcgaccaactcgggcctcattggctgggtt
ccccactgtgacacactgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacatcgagcatcgcatcatgttgcggatggctccggactatgaccacttgactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctccgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctgcgagagcacaaggacagtgtcatggccgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatcccgaacgaggacggattcctactctgctggccagtcagtcgaaattttggacggt
gtggaacttggagagccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagacggtttggtgaaaccagaggccctaaataagaaagctatccagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctatattggctggtgccctttctggtaa

KEGG   Homo sapiens (human): 4790
Entry
4790              CDS       T01001                                 
Symbol
NFKB1, CVID12, EBP-1, KBF1, NF-kB, NF-kB1, NF-kappa-B1, NF-kappaB, NF-kappabeta, NFKB-p105, NFKB-p50, NFkappaB
Name
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04936  Alcoholic liver disease
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05030  Cocaine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06133  RLR signaling (viruses)
nt06139  NLR signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06214  PI3K signaling
nt06223  TNF signaling
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06417  AGE-RAGE signaling
nt06460  Alzheimer disease
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00269  HCV core to TNF-NFKB signaling pathway
N00389  HCMV IE1-72 to transcription
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00398  HCMV IE2-86 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00443  HIV Vpr/Nef/Tat to TNF-NFKB signaling pathway
N00501  HTLV-1 Tax to EGFR-PI3K-NFKB signaling pathway
N00504  HTLV-1 Tax to NFKB signaling pathway
N00550  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
N00932  Escherichia NleH1 to TNF-NFKB signaling pathway
N00940  NOD-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01112  Salmonella SopE/E2 to NOD-NFKB signaling pathway
N01115  Salmonella SseL to TNF-NFKB signaling pathway
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
N01306  AngII-AT1R-NOX2 signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
N01339  NNK/NNN to PI3K signaling pathway
N01410  Metals to NFKB signaling pathway
N01411  Metals to NFKB signaling pathway
Disease
H00088  Common variable immunodeficiency
Drug target
Iguratimod: D01146<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4790 (NFKB1)
   04014 Ras signaling pathway
    4790 (NFKB1)
   04064 NF-kappa B signaling pathway
    4790 (NFKB1)
   04668 TNF signaling pathway
    4790 (NFKB1)
   04066 HIF-1 signaling pathway
    4790 (NFKB1)
   04071 Sphingolipid signaling pathway
    4790 (NFKB1)
   04024 cAMP signaling pathway
    4790 (NFKB1)
   04151 PI3K-Akt signaling pathway
    4790 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4790 (NFKB1)
   04218 Cellular senescence
    4790 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    4790 (NFKB1)
   04620 Toll-like receptor signaling pathway
    4790 (NFKB1)
   04621 NOD-like receptor signaling pathway
    4790 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    4790 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    4790 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    4790 (NFKB1)
   04660 T cell receptor signaling pathway
    4790 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    4790 (NFKB1)
   04659 Th17 cell differentiation
    4790 (NFKB1)
   04657 IL-17 signaling pathway
    4790 (NFKB1)
   04662 B cell receptor signaling pathway
    4790 (NFKB1)
   04062 Chemokine signaling pathway
    4790 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    4790 (NFKB1)
   04917 Prolactin signaling pathway
    4790 (NFKB1)
   04926 Relaxin signaling pathway
    4790 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4790 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    4790 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    4790 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4790 (NFKB1)
   05202 Transcriptional misregulation in cancer
    4790 (NFKB1)
   05206 MicroRNAs in cancer
    4790 (NFKB1)
   05207 Chemical carcinogenesis - receptor activation
    4790 (NFKB1)
   05208 Chemical carcinogenesis - reactive oxygen species
    4790 (NFKB1)
   05203 Viral carcinogenesis
    4790 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4790 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    4790 (NFKB1)
   05221 Acute myeloid leukemia
    4790 (NFKB1)
   05220 Chronic myeloid leukemia
    4790 (NFKB1)
   05215 Prostate cancer
    4790 (NFKB1)
   05222 Small cell lung cancer
    4790 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4790 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    4790 (NFKB1)
   05161 Hepatitis B
    4790 (NFKB1)
   05160 Hepatitis C
    4790 (NFKB1)
   05171 Coronavirus disease - COVID-19
    4790 (NFKB1)
   05164 Influenza A
    4790 (NFKB1)
   05162 Measles
    4790 (NFKB1)
   05168 Herpes simplex virus 1 infection
    4790 (NFKB1)
   05163 Human cytomegalovirus infection
    4790 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4790 (NFKB1)
   05169 Epstein-Barr virus infection
    4790 (NFKB1)
   05165 Human papillomavirus infection
    4790 (NFKB1)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4790 (NFKB1)
   05130 Pathogenic Escherichia coli infection
    4790 (NFKB1)
   05132 Salmonella infection
    4790 (NFKB1)
   05131 Shigellosis
    4790 (NFKB1)
   05135 Yersinia infection
    4790 (NFKB1)
   05133 Pertussis
    4790 (NFKB1)
   05134 Legionellosis
    4790 (NFKB1)
   05152 Tuberculosis
    4790 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    4790 (NFKB1)
   05145 Toxoplasmosis
    4790 (NFKB1)
   05140 Leishmaniasis
    4790 (NFKB1)
   05142 Chagas disease
    4790 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    4790 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4790 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    4790 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    4790 (NFKB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    4790 (NFKB1)
   05418 Fluid shear stress and atherosclerosis
    4790 (NFKB1)
   05415 Diabetic cardiomyopathy
    4790 (NFKB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    4790 (NFKB1)
   04932 Non-alcoholic fatty liver disease
    4790 (NFKB1)
   04931 Insulin resistance
    4790 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    4790 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    4790 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4790 (NFKB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    4790 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 4790
NCBI-ProteinID: NP_001158884
OMIM: 164011
HGNC: 7794
Ensembl: ENSG00000109320
Pharos: P19838(Tchem)
UniProt: P19838
Structure
LinkDB
Position
4:102501359..102617302
AA seq 968 aa
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggcagaagatgatccatatttgggaaggcctgaacaaatgtttcatttggatccttct
ttgactcatacaatatttaatccagaagtatttcaaccacagatggcactgccaacagat
ggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactacctggtgcctctagtgaaaagaacaagaagtct
taccctcaggtcaaaatctgcaactatgtgggaccagcaaaggttattgttcagttggtc
acaaatggaaaaaatatccacctgcatgcccacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggcttcgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggcg
tgtataaggggctataatcctggactcttggtgcaccctgaccttgcctatttgcaagca
gaaggtggaggggaccggcagctgggagatcgggaaaaagagctaatccgccaagcagct
ctgcagcagaccaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccggatagcactggcagcttcacaaggcgcctggaacccgtggtatcagacgccatctat
gacagtaaagcccccaatgcatccaacttgaaaattgtaagaatggacaggacagctgga
tgtgtgactggaggggaggaaatttatcttctttgtgacaaagttcagaaagatgacatc
cagattcgattttatgaagaggaagaaaatggtggagtctgggaaggatttggagatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaactccaaagtataaagat
attaatattacaaaaccagcctctgtgtttgtccagcttcggaggaaatctgacttggaa
actagtgaaccaaaacctttcctctactatcctgaaatcaaagataaagaagaagtgcag
aggaaacgtcagaagctcatgcccaatttttcggatagtttcggcggtggtagtggtgct
ggagctggaggcggaggcatgtttggtagtggcggtggaggagggggcactggaagtaca
ggtccagggtatagcttcccacactatggatttcctacttatggtgggattactttccat
cctggaactactaaatctaatgctgggatgaagcatggaaccatggacactgaatctaaa
aaggaccctgaaggttgtgacaaaagtgatgacaaaaacactgtaaacctctttgggaaa
gttattgaaaccacagagcaagatcaggagcccagcgaggccaccgttgggaatggtgag
gtcactctaacgtatgcaacaggaacaaaagaagagagtgctggagttcaggataacctc
tttctagagaaggctatgcagcttgcaaagaggcatgccaatgcccttttcgactacgcg
gtgacaggagacgtgaagatgctgctggccgtccagcgccatctcactgctgtgcaggat
gagaatggggacagtgtcttacacttagcaatcatccaccttcattctcaacttgtgagg
gatctactagaagtcacatctggtttgatttctgatgacattatcaacatgagaaatgat
ctgtaccagacgcccttgcacttggcagtgatcactaagcaggaagatgtggtggaggat
ttgctgagggctggggccgacctgagccttctggaccgcttgggtaactctgttttgcac
ctagctgccaaagaaggacatgataaagttctcagtatcttactcaagcacaaaaaggca
gcactacttcttgaccaccccaacggggacggtctgaatgccattcatctagccatgatg
agcaatagcctgccatgtttgctgctgctggtggccgctggggctgacgtcaatgctcag
gagcagaagtccgggcgcacagcactgcacctggctgtggagcacgacaacatctcattg
gcaggctgcctgctcctggagggtgatgcccatgtggacagtactacctacgatggaacc
acacccctgcatatagcagctgggagagggtccaccaggctggcagctcttctcaaagca
gcaggagcagatcccctggtggagaactttgagcctctctatgacctggatgactcttgg
gaaaatgcaggagaggatgaaggagttgtgcctggaaccacgcctctagatatggccacc
agctggcaggtatttgacatattaaatgggaaaccatatgagccagagtttacatctgat
gatttactagcacaaggagacatgaaacagctggctgaagatgtgaagctgcagctgtat
aagttactagaaattcctgatccagacaaaaactgggctactctggcgcagaaattaggt
ctggggatacttaataatgccttccggctgagtcctgctccttccaaaacacttatggac
aactatgaggtctctgggggtacagtcagagagctggtggaggccctgagacaaatgggc
tacaccgaagcaattgaagtgatccaggcagcctccagcccagtgaagaccacctctcag
gcccactcgctgcctctctcgcctgcctccacaaggcagcaaatagacgagctccgagac
agtgacagtgtctgcgacagcggcgtggagacatccttccgcaaactcagctttaccgag
tctctgaccagtggtgcctcactgctaactctcaacaaaatgccccatgattatgggcag
gaaggacctctagaaggcaaaatttag

KEGG   Homo sapiens (human): 5970
Entry
5970              CDS       T01001                                 
Symbol
RELA, CMCU, NFKB3, p65
Name
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04936  Alcoholic liver disease
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05030  Cocaine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease
hsa05415  Diabetic cardiomyopathy
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06133  RLR signaling (viruses)
nt06139  NLR signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06214  PI3K signaling
nt06223  TNF signaling
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06417  AGE-RAGE signaling
nt06460  Alzheimer disease
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00269  HCV core to TNF-NFKB signaling pathway
N00389  HCMV IE1-72 to transcription
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00398  HCMV IE2-86 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00443  HIV Vpr/Nef/Tat to TNF-NFKB signaling pathway
N00501  HTLV-1 Tax to EGFR-PI3K-NFKB signaling pathway
N00504  HTLV-1 Tax to NFKB signaling pathway
N00550  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
N00929  Escherichia NleC to TNF-NFKB signaling pathway
N00932  Escherichia NleH1 to TNF-NFKB signaling pathway
N00940  NOD-NFKB signaling pathway
N00943  Shigella IpaH4.5 to TNF-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01112  Salmonella SopE/E2 to NOD-NFKB signaling pathway
N01115  Salmonella SseL to TNF-NFKB signaling pathway
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
N01122  Salmonella PipA/GogA/GtgA to TNF-NFKB signaling pathway
N01306  AngII-AT1R-NOX2 signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
N01339  NNK/NNN to PI3K signaling pathway
N01410  Metals to NFKB signaling pathway
N01411  Metals to NFKB signaling pathway
Drug target
Edasalonexent: D12181
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5970 (RELA)
   04014 Ras signaling pathway
    5970 (RELA)
   04064 NF-kappa B signaling pathway
    5970 (RELA)
   04668 TNF signaling pathway
    5970 (RELA)
   04066 HIF-1 signaling pathway
    5970 (RELA)
   04071 Sphingolipid signaling pathway
    5970 (RELA)
   04024 cAMP signaling pathway
    5970 (RELA)
   04151 PI3K-Akt signaling pathway
    5970 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    5970 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    5970 (RELA)
   04218 Cellular senescence
    5970 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    5970 (RELA)
   04620 Toll-like receptor signaling pathway
    5970 (RELA)
   04621 NOD-like receptor signaling pathway
    5970 (RELA)
   04622 RIG-I-like receptor signaling pathway
    5970 (RELA)
   04623 Cytosolic DNA-sensing pathway
    5970 (RELA)
   04625 C-type lectin receptor signaling pathway
    5970 (RELA)
   04660 T cell receptor signaling pathway
    5970 (RELA)
   04658 Th1 and Th2 cell differentiation
    5970 (RELA)
   04659 Th17 cell differentiation
    5970 (RELA)
   04657 IL-17 signaling pathway
    5970 (RELA)
   04662 B cell receptor signaling pathway
    5970 (RELA)
   04062 Chemokine signaling pathway
    5970 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    5970 (RELA)
   04917 Prolactin signaling pathway
    5970 (RELA)
   04926 Relaxin signaling pathway
    5970 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5970 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5970 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    5970 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5970 (RELA)
   05202 Transcriptional misregulation in cancer
    5970 (RELA)
   05207 Chemical carcinogenesis - receptor activation
    5970 (RELA)
   05208 Chemical carcinogenesis - reactive oxygen species
    5970 (RELA)
   05203 Viral carcinogenesis
    5970 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5970 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    5970 (RELA)
   05221 Acute myeloid leukemia
    5970 (RELA)
   05220 Chronic myeloid leukemia
    5970 (RELA)
   05215 Prostate cancer
    5970 (RELA)
   05222 Small cell lung cancer
    5970 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5970 (RELA)
   05170 Human immunodeficiency virus 1 infection
    5970 (RELA)
   05161 Hepatitis B
    5970 (RELA)
   05160 Hepatitis C
    5970 (RELA)
   05171 Coronavirus disease - COVID-19
    5970 (RELA)
   05164 Influenza A
    5970 (RELA)
   05162 Measles
    5970 (RELA)
   05168 Herpes simplex virus 1 infection
    5970 (RELA)
   05163 Human cytomegalovirus infection
    5970 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5970 (RELA)
   05169 Epstein-Barr virus infection
    5970 (RELA)
   05165 Human papillomavirus infection
    5970 (RELA)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5970 (RELA)
   05130 Pathogenic Escherichia coli infection
    5970 (RELA)
   05132 Salmonella infection
    5970 (RELA)
   05131 Shigellosis
    5970 (RELA)
   05135 Yersinia infection
    5970 (RELA)
   05133 Pertussis
    5970 (RELA)
   05134 Legionellosis
    5970 (RELA)
   05152 Tuberculosis
    5970 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5970 (RELA)
   05145 Toxoplasmosis
    5970 (RELA)
   05140 Leishmaniasis
    5970 (RELA)
   05142 Chagas disease
    5970 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    5970 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5970 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    5970 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    5970 (RELA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5970 (RELA)
   05418 Fluid shear stress and atherosclerosis
    5970 (RELA)
   05415 Diabetic cardiomyopathy
    5970 (RELA)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    5970 (RELA)
   04932 Non-alcoholic fatty liver disease
    5970 (RELA)
   04931 Insulin resistance
    5970 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5970 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    5970 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5970 (RELA)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5970 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Fimbrial_CS1
Other DBs
NCBI-GeneID: 5970
NCBI-ProteinID: NP_068810
OMIM: 164014
HGNC: 9955
Ensembl: ENSG00000173039
Pharos: Q04206(Tchem)
UniProt: Q04206
Structure
LinkDB
Position
11:complement(65653601..65662916)
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtgcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagatcagccaggcctcggccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gctgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

KEGG   Homo sapiens (human): 332
Entry
332               CDS       T01001                                 
Symbol
BIRC5, API4, EPR-1
Name
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04390  Hippo signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06214  PI3K signaling
nt06215  WNT signaling
nt06230  Cell cycle
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06271  Endometrial cancer
  Element
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00533  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
N01339  NNK/NNN to PI3K signaling pathway
Drug target
Gataparsen (DG01431): D09909 D09910
Sepantronium bromide: D10164
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    332 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    332 (BIRC5)
   04215 Apoptosis - multiple species
    332 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    332 (BIRC5)
   05207 Chemical carcinogenesis - receptor activation
    332 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    332 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    332 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    332 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    332 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    332 (BIRC5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   332 (BIRC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     332 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 332
NCBI-ProteinID: NP_001159
OMIM: 603352
HGNC: 593
Ensembl: ENSG00000089685
Pharos: O15392(Tchem)
UniProt: O15392 A0A0B4J1S3
Structure
LinkDB
Position
17:78214253..78225635
AA seq 142 aa
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtccggttgcgctttcctttctgtcaagaagcagtttgaagaattaacccttggtgaa
tttttgaaactggacagagaaagagccaagaacaaaattgcaaaggaaaccaacaataag
aagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctgcc
atggattga

DBGET integrated database retrieval system