Entry |
|
Symbol |
KRAS, 'C-K-RAS, C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras, K-Ras_2, KI-RAS, KRAS1, KRAS2, NS, NS3, OES, RALD, RASK2, c-Ki-ras, c-Ki-ras2
|
Name |
(RefSeq) KRAS proto-oncogene, GTPase
|
KO |
|
Organism |
|
Pathway |
hsa01521 | EGFR tyrosine kinase inhibitor resistance |
hsa04072 | Phospholipase D signaling pathway |
hsa04213 | Longevity regulating pathway - multiple species |
hsa04550 | Signaling pathways regulating pluripotency of stem cells |
hsa04625 | C-type lectin receptor signaling pathway |
hsa04650 | Natural killer cell mediated cytotoxicity |
hsa04660 | T cell receptor signaling pathway |
hsa04662 | B cell receptor signaling pathway |
hsa04664 | Fc epsilon RI signaling pathway |
hsa04810 | Regulation of actin cytoskeleton |
hsa04914 | Progesterone-mediated oocyte maturation |
hsa04919 | Thyroid hormone signaling pathway |
hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
hsa04935 | Growth hormone synthesis, secretion and action |
hsa04960 | Aldosterone-regulated sodium reabsorption |
hsa05022 | Pathways of neurodegeneration - multiple diseases |
hsa05163 | Human cytomegalovirus infection |
hsa05166 | Human T-cell leukemia virus 1 infection |
hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
hsa05170 | Human immunodeficiency virus 1 infection |
hsa05207 | Chemical carcinogenesis - receptor activation |
hsa05208 | Chemical carcinogenesis - reactive oxygen species |
hsa05230 | Central carbon metabolism in cancer |
hsa05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
|
Network |
|
Element |
N00001 | EGF-EGFR-RAS-ERK signaling pathway |
N00002 | BCR-ABL fusion kinase to RAS-ERK signaling pathway |
N00003 | Mutation-activated KIT to RAS-ERK signaling pathway |
N00004 | Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway |
N00005 | Mutation-activated MET to RAS-ERK signaling pathway |
N00006 | Amplified EGFR to RAS-ERK signaling pathway |
N00007 | EML4-ALK fusion kinase to RAS-ERK signaling pathway |
N00008 | RET fusion kinase to RAS-ERK signaling pathway |
N00009 | TRK fusion kinase to RAS-ERK signaling pathway |
N00011 | Mutation-activated FGFR3 to RAS-ERK signaling pathway |
N00012 | Mutation-activated KRAS/NRAS to ERK signaling pathway |
N00014 | Mutation-activated EGFR to RAS-ERK signaling pathway |
N00015 | PDGF-PDGFR-RAS-ERK signaling pathway |
N00016 | PDGF-overexpression to RAS-ERK signaling pathway |
N00018 | Amplified PDGFR to RAS-ERK signaling pathway |
N00019 | FGF-FGFR-RAS-ERK signaling pathway |
N00020 | Amplified FGFR to RAS-ERK signaling pathway |
N00021 | EGF-ERBB2-RAS-ERK signaling pathway |
N00022 | ERBB2-overexpression to RAS-ERK signaling pathway |
N00030 | EGF-EGFR-RAS-PI3K signaling pathway |
N00031 | Duplication or mutation-activated FLT3 to RAS-PI3K signaling pathway |
N00032 | Mutation-activated KRAS/NRAS to PI3K signaling pathway |
N00041 | EGFR-overexpression to RAS-ERK signaling pathway |
N00096 | EGF-EGFR-RAS-RASSF1 signaling pathway |
N00097 | Loss of RASSF1 to RAS-RASSF1 signaling pathway |
N00103 | EGF-EGFR-RAS-RalGDS signaling pathway |
N00104 | Mutation-activated KRAS to RalGDS signaling pathway |
N00152 | CXCR-GNB/G-ERK signaling pathway |
N00160 | KSHV K1 to RAS-ERK signaling pathway |
N00215 | KITLG-KIT-RAS-ERK signaling pathway |
N00216 | HGF-MET-RAS-ERK signaling pathway |
N00217 | FLT3LG-FLT3-RAS-ERK signaling pathway |
N00218 | FLT3LG-FLT3-RAS-PI3K signaling pathway |
N00229 | TGFA-EGFR-RAS-ERK signaling pathway |
N00230 | TGFA-overexpression to RAS-ERK signaling pathway |
N00233 | IGF-IGF1R-RAS-ERK signaling pathway |
N00235 | IGF2-overexpression to RAS-ERK signaling pathway |
N00237 | IGF1R-overexpression to RAS-ERK signaling pathway |
N00246 | HGF-overexpression to RAS-ERK signaling pathway |
N00248 | MET-overexpression to RAS-ERK signaling pathway |
N00252 | Amplified ERBB2 to RAS-ERK signaling pathway |
N00259 | Amplified MET to RAS-ERK signaling pathway |
N00276 | EGF-overexpression to RAS-ERK signaling pathway |
N00277 | EREG-EGFR-RAS-ERK signaling pathway |
N00278 | EREG-overexpression to RAS-ERK signaling pathway |
N00279 | AREG-EGFR-RAS-ERK signaling pathway |
N00280 | AREG-overexpression to RAS-ERK signaling pathway |
N00367 | HPV E5 to EGFR-RAS-ERK signaling pathway |
N00386 | HCMV gB to PDGFR-RAS-ERK signaling pathway |
N00513 | Mutation-activated EGFR to RAS-ERK signaling pathway |
N00538 | Ca2+-PYK2-RAS-ERK signaling pathway |
N00540 | HBV HBx to RAS-ERK signaling pathway |
N00541 | HBV HBx to RAS-ERK signaling pathway |
N00542 | EGF-EGFR-RAS-JNK signaling pathway |
N00994 | AGE-RAGE signaling pathway |
N00996 | Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway |
N01062 | Mutation-activated MET to RAS-ERK signaling pathway |
N01064 | Mutation-activated RET to RAS-ERK signaling pathway |
N01343 | ACH-CHRN-RAS-ERK signaling pathway |
N01344 | NNK/NNN to RAS-ERK signaling pathway |
N01351 | E2-ER-RAS-ERK signaling pathway |
N01352 | BPA to RAS-ERK signaling pathway |
N01353 | E2 to RAS-ERK signaling pathway |
N01354 | BPA to RAS-ERK signaling pathway |
N01360 | P4-PR-RAS-ERK signaling pathway |
N01361 | P4/MPA to PR-RAS-ERK signaling pathway |
N01408 | Metals to RAS-ERK signaling pathway |
N01592 | GF-RTK-RAS-ERK signaling pathway |
N01596 | Regulation of GF-RTK-RAS-ERK signaling, RAS ubiquitination by CUL3 complex |
N01597 | Regulation of GF-RTK-RAS-ERK signaling, SPRED and NF1 |
N01600 | Regulation of GF-RTK-RAS-ERK signaling, RasGAP |
N01658 | GF-RTK-RAS-PI3K signaling pathway |
|
Disease |
H00014 | Non-small cell lung cancer |
H00040 | Squamous cell carcinoma |
H00458 | Syndromic craniosynostoses |
H00523 | Noonan syndrome and related disorders |
H01592 | Medullary thyroid cancer |
H01745 | Cardiofaciocutaneous syndrome |
H02410 | Myelodysplastic/myeloproliferative neoplasms |
H02411 | Chronic myelomonocytic leukemia |
H02412 | Atypical chronic myeloid leukemia |
H02425 | Erdheim-Chester disease |
H02541 | Juvenile myelomonocytic leukemia |
H02628 | Schimmelpenning-Feuerstein-Mims syndrome |
|
Drug target |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
3845 (KRAS)
04012 ErbB signaling pathway
3845 (KRAS)
04014 Ras signaling pathway
3845 (KRAS)
04015 Rap1 signaling pathway
3845 (KRAS)
04370 VEGF signaling pathway
3845 (KRAS)
04371 Apelin signaling pathway
3845 (KRAS)
04068 FoxO signaling pathway
3845 (KRAS)
04072 Phospholipase D signaling pathway
3845 (KRAS)
04071 Sphingolipid signaling pathway
3845 (KRAS)
04151 PI3K-Akt signaling pathway
3845 (KRAS)
04150 mTOR signaling pathway
3845 (KRAS)
09140 Cellular Processes
09141 Transport and catabolism
04140 Autophagy - animal
3845 (KRAS)
04137 Mitophagy - animal
3845 (KRAS)
09143 Cell growth and death
04210 Apoptosis
3845 (KRAS)
04218 Cellular senescence
3845 (KRAS)
09144 Cellular community - eukaryotes
04540 Gap junction
3845 (KRAS)
04550 Signaling pathways regulating pluripotency of stem cells
3845 (KRAS)
09142 Cell motility
04810 Regulation of actin cytoskeleton
3845 (KRAS)
09150 Organismal Systems
09151 Immune system
04625 C-type lectin receptor signaling pathway
3845 (KRAS)
04650 Natural killer cell mediated cytotoxicity
3845 (KRAS)
04660 T cell receptor signaling pathway
3845 (KRAS)
04662 B cell receptor signaling pathway
3845 (KRAS)
04664 Fc epsilon RI signaling pathway
3845 (KRAS)
04062 Chemokine signaling pathway
3845 (KRAS)
09152 Endocrine system
04910 Insulin signaling pathway
3845 (KRAS)
04929 GnRH secretion
3845 (KRAS)
04912 GnRH signaling pathway
3845 (KRAS)
04915 Estrogen signaling pathway
3845 (KRAS)
04914 Progesterone-mediated oocyte maturation
3845 (KRAS)
04917 Prolactin signaling pathway
3845 (KRAS)
04921 Oxytocin signaling pathway
3845 (KRAS)
04926 Relaxin signaling pathway
3845 (KRAS)
04935 Growth hormone synthesis, secretion and action
3845 (KRAS)
04919 Thyroid hormone signaling pathway
3845 (KRAS)
04916 Melanogenesis
3845 (KRAS)
09155 Excretory system
04960 Aldosterone-regulated sodium reabsorption
3845 (KRAS)
09156 Nervous system
04725 Cholinergic synapse
3845 (KRAS)
04726 Serotonergic synapse
3845 (KRAS)
04720 Long-term potentiation
3845 (KRAS)
04730 Long-term depression
3845 (KRAS)
04722 Neurotrophin signaling pathway
3845 (KRAS)
09158 Development and regeneration
04360 Axon guidance
3845 (KRAS)
09149 Aging
04211 Longevity regulating pathway
3845 (KRAS)
04213 Longevity regulating pathway - multiple species
3845 (KRAS)
09159 Environmental adaptation
04714 Thermogenesis
3845 (KRAS)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
3845 (KRAS)
05206 MicroRNAs in cancer
3845 (KRAS)
05205 Proteoglycans in cancer
3845 (KRAS)
05207 Chemical carcinogenesis - receptor activation
3845 (KRAS)
05208 Chemical carcinogenesis - reactive oxygen species
3845 (KRAS)
05203 Viral carcinogenesis
3845 (KRAS)
05230 Central carbon metabolism in cancer
3845 (KRAS)
05231 Choline metabolism in cancer
3845 (KRAS)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
3845 (KRAS)
09162 Cancer: specific types
05210 Colorectal cancer
3845 (KRAS)
05212 Pancreatic cancer
3845 (KRAS)
05225 Hepatocellular carcinoma
3845 (KRAS)
05226 Gastric cancer
3845 (KRAS)
05214 Glioma
3845 (KRAS)
05216 Thyroid cancer
3845 (KRAS)
05221 Acute myeloid leukemia
3845 (KRAS)
05220 Chronic myeloid leukemia
3845 (KRAS)
05218 Melanoma
3845 (KRAS)
05211 Renal cell carcinoma
3845 (KRAS)
05219 Bladder cancer
3845 (KRAS)
05215 Prostate cancer
3845 (KRAS)
05213 Endometrial cancer
3845 (KRAS)
05224 Breast cancer
3845 (KRAS)
05223 Non-small cell lung cancer
3845 (KRAS)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
3845 (KRAS)
05170 Human immunodeficiency virus 1 infection
3845 (KRAS)
05161 Hepatitis B
3845 (KRAS)
05160 Hepatitis C
3845 (KRAS)
05163 Human cytomegalovirus infection
3845 (KRAS)
05167 Kaposi sarcoma-associated herpesvirus infection
3845 (KRAS)
05165 Human papillomavirus infection
3845 (KRAS)
09164 Neurodegenerative disease
05010 Alzheimer disease
3845 (KRAS)
05022 Pathways of neurodegeneration - multiple diseases
3845 (KRAS)
09165 Substance dependence
05034 Alcoholism
3845 (KRAS)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
3845 (KRAS)
09167 Endocrine and metabolic disease
04933 AGE-RAGE signaling pathway in diabetic complications
3845 (KRAS)
09176 Drug resistance: antineoplastic
01521 EGFR tyrosine kinase inhibitor resistance
3845 (KRAS)
01522 Endocrine resistance
3845 (KRAS)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:hsa04131]
3845 (KRAS)
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:hsa04031]
3845 (KRAS)
Membrane trafficking [BR:hsa04131]
Endocytosis
Macropinocytosis
Ras GTPases
3845 (KRAS)
GTP-binding proteins [BR:hsa04031]
Small (monomeric) G-proteins
Ras Family
Ras [OT]
3845 (KRAS)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
12:complement(25205246..25250929)
|
AA seq |
189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM |
NT seq |
570 nt +upstreamnt +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa |