179 aa
MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLA
KEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVP
FLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
KEGG Orthology (KO) [BR:hsa00001]
09100 Metabolism
09103 Lipid metabolism
00140 Steroid hormone biosynthesis
1543 (CYP1A1)
09105 Amino acid metabolism
00380 Tryptophan metabolism
1543 (CYP1A1)
09108 Metabolism of cofactors and vitamins
00830 Retinol metabolism
1543 (CYP1A1)
09111 Xenobiotics biodegradation and metabolism
00980 Metabolism of xenobiotics by cytochrome P450
1543 (CYP1A1)
09150 Organismal Systems
09152 Endocrine system
04913 Ovarian steroidogenesis
1543 (CYP1A1)
09160 Human Diseases
09161 Cancer: overview
05204 Chemical carcinogenesis - DNA adducts
1543 (CYP1A1)
05207 Chemical carcinogenesis - receptor activation
1543 (CYP1A1)
05208 Chemical carcinogenesis - reactive oxygen species
1543 (CYP1A1)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
1543 (CYP1A1)
09180 Brite Hierarchies
09181 Protein families: metabolism
00199 Cytochrome P450 [BR:hsa00199]
1543 (CYP1A1)
Enzymes [BR:hsa01000]
1. Oxidoreductases
1.14 Acting on paired donors, with incorporation or reduction of molecular oxygen
1.14.14 With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
1.14.14.1 unspecific monooxygenase
1543 (CYP1A1)
Cytochrome P450 [BR:hsa00199]
Cytochrome P450, animal type
CYP1 family
1543 (CYP1A1)
KEGG Orthology (KO) [BR:hsa00001]
09100 Metabolism
09103 Lipid metabolism
00140 Steroid hormone biosynthesis
1545 (CYP1B1)
09105 Amino acid metabolism
00380 Tryptophan metabolism
1545 (CYP1B1)
09111 Xenobiotics biodegradation and metabolism
00980 Metabolism of xenobiotics by cytochrome P450
1545 (CYP1B1)
09150 Organismal Systems
09152 Endocrine system
04913 Ovarian steroidogenesis
1545 (CYP1B1)
09160 Human Diseases
09161 Cancer: overview
05206 MicroRNAs in cancer
1545 (CYP1B1)
05204 Chemical carcinogenesis - DNA adducts
1545 (CYP1B1)
05207 Chemical carcinogenesis - receptor activation
1545 (CYP1B1)
05208 Chemical carcinogenesis - reactive oxygen species
1545 (CYP1B1)
09180 Brite Hierarchies
09181 Protein families: metabolism
00199 Cytochrome P450 [BR:hsa00199]
1545 (CYP1B1)
Enzymes [BR:hsa01000]
1. Oxidoreductases
1.14 Acting on paired donors, with incorporation or reduction of molecular oxygen
1.14.14 With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
1.14.14.1 unspecific monooxygenase
1545 (CYP1B1)
Cytochrome P450 [BR:hsa00199]
Cytochrome P450, animal type
CYP1 family
1545 (CYP1B1)